BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0596 (600 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase rever... 23 2.6 AF265297-1|AAG17640.1| 125|Tribolium castaneum putative cytochr... 22 3.4 AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone recepto... 21 7.9 AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory recept... 21 7.9 AM292337-1|CAL23149.2| 452|Tribolium castaneum gustatory recept... 21 7.9 >DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase reverse transcriptase protein. Length = 596 Score = 22.6 bits (46), Expect = 2.6 Identities = 10/26 (38%), Positives = 13/26 (50%) Frame = -1 Query: 270 PNTAVRHSLTLAIFRSVTFSDDSARF 193 PN +RH L F + D+ ARF Sbjct: 409 PNYEIRHKFKLWNFNNQISDDNPARF 434 >AF265297-1|AAG17640.1| 125|Tribolium castaneum putative cytochrome P450 monooxigenase protein. Length = 125 Score = 22.2 bits (45), Expect = 3.4 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = -1 Query: 465 VPFSARSLNESLVEAXRSKL 406 VPF ARSL E +V KL Sbjct: 61 VPFIARSLGEDIVTYSGHKL 80 >AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone receptor (isoform A) protein. Length = 549 Score = 21.0 bits (42), Expect = 7.9 Identities = 11/40 (27%), Positives = 20/40 (50%) Frame = +1 Query: 475 RGRTENLFXEFSYGQKPETGLGKRRKAVDLRDGXVRRCVA 594 R T+N + YG E + RRK + R +++C++ Sbjct: 214 RSITKNAVYQCKYGNNCEIDMYMRRKCQECR---LKKCLS 250 >AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory receptor candidate 48 protein. Length = 408 Score = 21.0 bits (42), Expect = 7.9 Identities = 7/27 (25%), Positives = 17/27 (62%) Frame = -3 Query: 550 FAVFQDQFPVFVHMKTL*IDFQFVREC 470 FA F FP+ ++++ +++ F ++C Sbjct: 29 FAHFICLFPITINIRKNGLNYNFTKKC 55 >AM292337-1|CAL23149.2| 452|Tribolium castaneum gustatory receptor candidate 16 protein. Length = 452 Score = 21.0 bits (42), Expect = 7.9 Identities = 12/35 (34%), Positives = 18/35 (51%) Frame = +2 Query: 56 LKILLEELKARAGPFAAVGKLTADKHATRRLIANV 160 L I+ E ++ PF + T + AT R IAN+ Sbjct: 52 LTIVFFEKRSALSPFELIQIRTINFVATFRTIANI 86 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 111,051 Number of Sequences: 336 Number of extensions: 1875 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15143945 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -