BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0594 (750 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292366-1|CAL23178.2| 379|Tribolium castaneum gustatory recept... 22 4.6 AM292329-1|CAL23141.2| 379|Tribolium castaneum gustatory recept... 22 4.6 EF222293-1|ABN79653.1| 434|Tribolium castaneum ecdysis triggeri... 21 8.0 >AM292366-1|CAL23178.2| 379|Tribolium castaneum gustatory receptor candidate 45 protein. Length = 379 Score = 22.2 bits (45), Expect = 4.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 683 WFNLSKKNNRSATFAHK 733 +FN SKK+ RS +F +K Sbjct: 3 YFNYSKKDIRSLSFFYK 19 Score = 21.4 bits (43), Expect = 8.0 Identities = 12/42 (28%), Positives = 20/42 (47%), Gaps = 6/42 (14%) Frame = +3 Query: 567 YIDRLAKTEEK------KNGSCEFKQYVLTYLLSLXSCSMGW 674 YID + K + +N S +F YV+ Y+L+ + W Sbjct: 116 YIDEVLKNRDSHETNLLRNVSVQFFVYVILYILATVFLAYVW 157 >AM292329-1|CAL23141.2| 379|Tribolium castaneum gustatory receptor candidate 8 protein. Length = 379 Score = 22.2 bits (45), Expect = 4.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 683 WFNLSKKNNRSATFAHK 733 +FN SKK+ RS +F +K Sbjct: 3 YFNYSKKDIRSLSFFYK 19 Score = 21.4 bits (43), Expect = 8.0 Identities = 12/42 (28%), Positives = 20/42 (47%), Gaps = 6/42 (14%) Frame = +3 Query: 567 YIDRLAKTEEK------KNGSCEFKQYVLTYLLSLXSCSMGW 674 YID + K + +N S +F YV+ Y+L+ + W Sbjct: 116 YIDEVLKNRDSHETNLLRNVSVQFFVYVILYILATVFLAYVW 157 >EF222293-1|ABN79653.1| 434|Tribolium castaneum ecdysis triggering hormone receptorisoform A protein. Length = 434 Score = 21.4 bits (43), Expect = 8.0 Identities = 7/22 (31%), Positives = 12/22 (54%) Frame = -3 Query: 289 EIYHLHFPKKNNYILFSQFVCY 224 ++YHL K N + F + + Y Sbjct: 320 QVYHLEIEKYYNILYFCRIMVY 341 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 168,733 Number of Sequences: 336 Number of extensions: 3393 Number of successful extensions: 12 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20027417 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -