BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0594 (750 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U55374-8|AAB36868.3| 1538|Caenorhabditis elegans Uncoordinated p... 30 2.0 U00047-11|AAU20827.1| 313|Caenorhabditis elegans Hypothetical p... 28 6.2 U00047-10|AAA50686.1| 471|Caenorhabditis elegans Hypothetical p... 28 6.2 U40419-7|AAL02444.1| 413|Caenorhabditis elegans Hypothetical pr... 28 8.1 >U55374-8|AAB36868.3| 1538|Caenorhabditis elegans Uncoordinated protein 2, isoform a protein. Length = 1538 Score = 29.9 bits (64), Expect = 2.0 Identities = 12/40 (30%), Positives = 22/40 (55%) Frame = +2 Query: 284 NFTDHSQMYFSSNYYKITHGHTAPN*NSLCNGYQRWTSTR 403 NF+++ +M S+ + KI H + + + L Y RW+ R Sbjct: 1479 NFSENDEMRCSTGFRKIPTSHRSVDKDCLAEAYDRWSLQR 1518 >U00047-11|AAU20827.1| 313|Caenorhabditis elegans Hypothetical protein ZK418.2b protein. Length = 313 Score = 28.3 bits (60), Expect = 6.2 Identities = 12/37 (32%), Positives = 22/37 (59%), Gaps = 1/37 (2%) Frame = +1 Query: 538 DHDNYKCSTITSIDSRKPKKKK-MAVVNLNSTF*RIY 645 D+ +Y C T+ ++DS K K +A++N+ T + Y Sbjct: 36 DNGSYSCDTLVTLDSFKTMTKNGVAIINVGMTIGKEY 72 >U00047-10|AAA50686.1| 471|Caenorhabditis elegans Hypothetical protein ZK418.2a protein. Length = 471 Score = 28.3 bits (60), Expect = 6.2 Identities = 12/37 (32%), Positives = 22/37 (59%), Gaps = 1/37 (2%) Frame = +1 Query: 538 DHDNYKCSTITSIDSRKPKKKK-MAVVNLNSTF*RIY 645 D+ +Y C T+ ++DS K K +A++N+ T + Y Sbjct: 194 DNGSYSCDTLVTLDSFKTMTKNGVAIINVGMTIGKEY 230 >U40419-7|AAL02444.1| 413|Caenorhabditis elegans Hypothetical protein C27F2.10 protein. Length = 413 Score = 27.9 bits (59), Expect = 8.1 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = -3 Query: 652 KLSKYVKTYCLNSQLPFFFSSVFASRS 572 K+SK+V TY ++Q PF + SRS Sbjct: 28 KISKFVSTYDEHAQEPFMHIEAYGSRS 54 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,655,938 Number of Sequences: 27780 Number of extensions: 294264 Number of successful extensions: 512 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 505 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 512 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1777507862 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -