BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0591 (700 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ011227-1|AAY63896.1| 484|Apis mellifera Amt-1-like protein pr... 25 0.52 AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-sy... 24 1.2 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 24 1.6 AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 23 2.8 AB022908-1|BAA86909.1| 493|Apis mellifera amylase protein. 23 3.7 AY661557-1|AAT74557.1| 411|Apis mellifera yellow-f-like protein... 22 4.9 AB253415-1|BAE86926.1| 588|Apis mellifera alpha-glucosidase pro... 22 4.9 DQ067178-1|AAZ20250.1| 448|Apis mellifera conserved ATPase doma... 22 6.4 AF393494-1|AAL60419.1| 144|Apis mellifera odorant binding prote... 22 6.4 AF166496-1|AAD51944.1| 144|Apis mellifera pheromone-binding pro... 22 6.4 DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. 21 8.5 AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 21 8.5 >DQ011227-1|AAY63896.1| 484|Apis mellifera Amt-1-like protein protein. Length = 484 Score = 25.4 bits (53), Expect = 0.52 Identities = 9/23 (39%), Positives = 15/23 (65%) Frame = -2 Query: 411 FWRYIAAALVLYFCGIVIPELMS 343 FW +I + ++L+F +IP MS Sbjct: 395 FWSFIVSTILLWFINKIIPIRMS 417 >AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-synthase protein. Length = 504 Score = 24.2 bits (50), Expect = 1.2 Identities = 19/45 (42%), Positives = 26/45 (57%), Gaps = 1/45 (2%) Frame = -2 Query: 399 IAAALVLYFCGIVIPELMSG*LSKNSRAFALPPTIIFS-SSTSFH 268 +AAA+ Y C IV+PE MS K S +AL II + + S+H Sbjct: 115 MAAAVRGYKCIIVMPEKMSD--EKISTLYALGAKIIRTPTEASWH 157 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 23.8 bits (49), Expect = 1.6 Identities = 10/35 (28%), Positives = 16/35 (45%) Frame = +3 Query: 537 ADLITTLATTASMEAAATPASVTPQSNRTRLPMSP 641 A ITT+ TT + T + TP + + +P Sbjct: 655 ATTITTITTTTTTTTTTTTTTTTPNTTQNASATTP 689 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 23.0 bits (47), Expect = 2.8 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = +3 Query: 198 WSARACIEASVFTCHSF 248 W +A IEA+V HSF Sbjct: 336 WKDKAMIEANVAVLHSF 352 >AB022908-1|BAA86909.1| 493|Apis mellifera amylase protein. Length = 493 Score = 22.6 bits (46), Expect = 3.7 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -2 Query: 159 GFRVPHSKHLWFSSRLRIEFNLR 91 GFRV +KH+W S I +R Sbjct: 203 GFRVDAAKHMWPSDLRTIYSRVR 225 >AY661557-1|AAT74557.1| 411|Apis mellifera yellow-f-like protein protein. Length = 411 Score = 22.2 bits (45), Expect = 4.9 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = +1 Query: 52 TFTNR*NGITTYQTQVELNP 111 T NR NGI + T ELNP Sbjct: 314 TQINR-NGIACWDTNTELNP 332 >AB253415-1|BAE86926.1| 588|Apis mellifera alpha-glucosidase protein. Length = 588 Score = 22.2 bits (45), Expect = 4.9 Identities = 9/22 (40%), Positives = 12/22 (54%) Frame = +2 Query: 458 KPETIEKPXEWLQSRDFYSSDN 523 +PET E EW D Y+ +N Sbjct: 268 QPETYELVKEWRDFVDNYAEEN 289 >DQ067178-1|AAZ20250.1| 448|Apis mellifera conserved ATPase domain protein protein. Length = 448 Score = 21.8 bits (44), Expect = 6.4 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = +2 Query: 581 GRYTGFGNSPKQSHSTSDVADAQRETKVVDNTL 679 G +GF NS K+ + + A A ++D +L Sbjct: 5 GLGSGFANSVKELRNLAQQAFAHSNQLIIDKSL 37 >AF393494-1|AAL60419.1| 144|Apis mellifera odorant binding protein ASP1 protein. Length = 144 Score = 21.8 bits (44), Expect = 6.4 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 491 LQSRDFYSSDNTLPTSGSDN 550 LQ R LPTSGSDN Sbjct: 103 LQERAQSVMGKCLPTSGSDN 122 >AF166496-1|AAD51944.1| 144|Apis mellifera pheromone-binding protein ASP1 protein. Length = 144 Score = 21.8 bits (44), Expect = 6.4 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 491 LQSRDFYSSDNTLPTSGSDN 550 LQ R LPTSGSDN Sbjct: 103 LQERAQSVMGKCLPTSGSDN 122 >DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. Length = 552 Score = 21.4 bits (43), Expect = 8.5 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = +2 Query: 440 WSPSDYKPETIEKPXEWLQSRDFYSSDNTLP 532 WS DY ++IE + DF ++N LP Sbjct: 160 WSTIDYTYDSIEARDSAIFDGDFI-TENNLP 189 >AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein 75 protein. Length = 900 Score = 21.4 bits (43), Expect = 8.5 Identities = 8/20 (40%), Positives = 10/20 (50%) Frame = -3 Query: 320 GPSRCLRPSFSQVPRPSTCP 261 G R S S+ P+P CP Sbjct: 550 GDDELHRASLSKTPQPPQCP 569 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 199,917 Number of Sequences: 438 Number of extensions: 4468 Number of successful extensions: 25 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 25 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 25 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21439440 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -