BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0590 (650 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_5952| Best HMM Match : zf-RanBP (HMM E-Value=0.76) 29 3.3 SB_23993| Best HMM Match : SRCR (HMM E-Value=0.0036) 29 4.3 SB_15350| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.3 >SB_5952| Best HMM Match : zf-RanBP (HMM E-Value=0.76) Length = 154 Score = 29.1 bits (62), Expect = 3.3 Identities = 10/17 (58%), Positives = 14/17 (82%) Frame = +1 Query: 142 EPKERWDCETILSTYSN 192 +PKE+WDCE+IL+ N Sbjct: 89 KPKEQWDCESILTCPEN 105 >SB_23993| Best HMM Match : SRCR (HMM E-Value=0.0036) Length = 189 Score = 28.7 bits (61), Expect = 4.3 Identities = 17/62 (27%), Positives = 28/62 (45%) Frame = +1 Query: 142 EPKERWDCETILSTYSNLYNHPKLIEEPKKPKRIVIDPKTGIPKDVLGADGGRLTVKALA 321 +P+ R DCE + YNH +L+++ P R+ G + + G D R+ A Sbjct: 63 DPRTRNDCEASPKSTPRNYNH-RLVDDSGDPTRV----GAGFLEVLFGTDWARINASAFP 117 Query: 322 RF 327 F Sbjct: 118 GF 119 >SB_15350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1126 Score = 28.7 bits (61), Expect = 4.3 Identities = 23/82 (28%), Positives = 37/82 (45%), Gaps = 1/82 (1%) Frame = +1 Query: 1 EAAAGRPGSSKPRRGSTSSTRKPK*GGYNVFRKSKKNLKKM-SSPWXVEPKERWDCETIL 177 E+ G+PG ++ + S +KPK G N + SK N + +PK + L Sbjct: 122 ESTQGKPGRGGRKQPARQSKKKPKRGVKNTKQASKNNDTTVEEEEKQTQPKRTTRSKRKL 181 Query: 178 STYSNLYNHPKLIEEPKKPKRI 243 + S + + EE KPKR+ Sbjct: 182 NDDS---SSKETEEENPKPKRV 200 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,075,370 Number of Sequences: 59808 Number of extensions: 216973 Number of successful extensions: 664 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 591 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 664 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1657237625 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -