BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0590 (650 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z81128-3|CAB03401.1| 410|Caenorhabditis elegans Hypothetical pr... 46 3e-05 AC024794-1|AAK68497.1| 994|Caenorhabditis elegans Hypothetical ... 28 6.6 >Z81128-3|CAB03401.1| 410|Caenorhabditis elegans Hypothetical protein T23D8.3 protein. Length = 410 Score = 45.6 bits (103), Expect = 3e-05 Identities = 17/44 (38%), Positives = 27/44 (61%) Frame = +1 Query: 97 KSKKNLKKMSSPWXVEPKERWDCETILSTYSNLYNHPKLIEEPK 228 K K+ + + K +WDCE+ + Y+N+YNHP LI+EP+ Sbjct: 266 KDKEEYEIVEVDEGTNKKMKWDCESFATQYTNIYNHPTLIKEPR 309 >AC024794-1|AAK68497.1| 994|Caenorhabditis elegans Hypothetical protein Y48G1BM.5 protein. Length = 994 Score = 27.9 bits (59), Expect = 6.6 Identities = 15/45 (33%), Positives = 24/45 (53%) Frame = +1 Query: 10 AGRPGSSKPRRGSTSSTRKPK*GGYNVFRKSKKNLKKMSSPWXVE 144 +G PGS P RGS S R+ + G R +++L + S W ++ Sbjct: 547 SGSPGSVDPIRGSRRSVRQDRCGA----RSDQQDLPRDGSLWRIQ 587 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,403,106 Number of Sequences: 27780 Number of extensions: 168217 Number of successful extensions: 593 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 578 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 593 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1444744186 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -