BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0588 (687 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ850293-1|CAH64513.1| 539|Tribolium castaneum putative esteras... 21 7.2 AY052622-1|AAL15470.1| 290|Tribolium castaneum kynurenine 3-mon... 21 9.5 AY052393-1|AAL15467.1| 445|Tribolium castaneum kynurenine 3-mon... 21 9.5 AY052391-1|AAL15465.1| 445|Tribolium castaneum kynurenine 3-mon... 21 9.5 >AJ850293-1|CAH64513.1| 539|Tribolium castaneum putative esterase protein. Length = 539 Score = 21.4 bits (43), Expect = 7.2 Identities = 13/48 (27%), Positives = 20/48 (41%) Frame = -3 Query: 571 KYYRIGDNNSTDLIVSGGGTGSNFANAGPNPRKRGGLSWSWRLSTVKL 428 KY + + + G GT +NF +P+ RG W +S L Sbjct: 181 KYIQHFGGTPDSITLFGDGTSANFHYL--SPQSRGLFHRGWSMSGTML 226 >AY052622-1|AAL15470.1| 290|Tribolium castaneum kynurenine 3-monooxygenase protein. Length = 290 Score = 21.0 bits (42), Expect = 9.5 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = -3 Query: 559 IGDNNSTDLIVSGGG 515 +G NN +IV GGG Sbjct: 1 MGSNNVNSVIVVGGG 15 >AY052393-1|AAL15467.1| 445|Tribolium castaneum kynurenine 3-monooxygenase protein. Length = 445 Score = 21.0 bits (42), Expect = 9.5 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = -3 Query: 559 IGDNNSTDLIVSGGG 515 +G NN +IV GGG Sbjct: 1 MGSNNVNSVIVVGGG 15 >AY052391-1|AAL15465.1| 445|Tribolium castaneum kynurenine 3-monooxygenase protein. Length = 445 Score = 21.0 bits (42), Expect = 9.5 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = -3 Query: 559 IGDNNSTDLIVSGGG 515 +G NN +IV GGG Sbjct: 1 MGSNNVNSVIVVGGG 15 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 132,273 Number of Sequences: 336 Number of extensions: 2705 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18010165 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -