BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0588 (687 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC57A7.05 |||conserved protein |Schizosaccharomyces pombe|chr ... 29 0.63 SPCC1672.04c |||mitochondrial copper ion transport protein|Schiz... 27 1.9 SPCC4G3.14 |mdj1||DNAJ domain protein Mdj1 |Schizosaccharomyces ... 27 3.4 SPAC6F6.06c |rax2||cell polarity factor Rax2|Schizosaccharomyces... 25 7.8 >SPAC57A7.05 |||conserved protein |Schizosaccharomyces pombe|chr 1|||Manual Length = 1337 Score = 29.1 bits (62), Expect = 0.63 Identities = 15/30 (50%), Positives = 20/30 (66%), Gaps = 1/30 (3%) Frame = -3 Query: 448 RLSTVKLSTP-NINAAAVNYPDPNNASTAS 362 RL++ +L+ P N N V Y P+NASTAS Sbjct: 584 RLASKQLNVPVNNNFRTVGYASPSNASTAS 613 >SPCC1672.04c |||mitochondrial copper ion transport protein|Schizosaccharomyces pombe|chr 3|||Manual Length = 101 Score = 27.5 bits (58), Expect = 1.9 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = -3 Query: 556 GDNNSTDLIVSGGGTGSNFANAGPNPRKRGG 464 GD N+T +S G+N +N+ + K GG Sbjct: 70 GDENATSTSLSSSNDGNNNSNSSSSDNKTGG 100 >SPCC4G3.14 |mdj1||DNAJ domain protein Mdj1 |Schizosaccharomyces pombe|chr 3|||Manual Length = 528 Score = 26.6 bits (56), Expect = 3.4 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = -3 Query: 556 GDNNSTDLIVSGGGTGSNFANAGPNPRKRGG 464 G +++T L V G G ++ A GPN + R G Sbjct: 318 GIDDNTVLRVMGAGNDASTAKGGPNAKSRPG 348 >SPAC6F6.06c |rax2||cell polarity factor Rax2|Schizosaccharomyces pombe|chr 1|||Manual Length = 1155 Score = 25.4 bits (53), Expect = 7.8 Identities = 9/21 (42%), Positives = 15/21 (71%) Frame = +1 Query: 418 SALTVLRWKVSNSNLTLLFFW 480 S ++ RW V+NSN+T+ F+ Sbjct: 148 SFTSIYRWNVTNSNVTIEHFY 168 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,286,483 Number of Sequences: 5004 Number of extensions: 41806 Number of successful extensions: 102 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 83 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 102 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 317927284 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -