BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0588 (687 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_33401| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 29 3.5 SB_31403| Best HMM Match : PAN (HMM E-Value=2.7e-18) 29 4.7 SB_14918| Best HMM Match : Extensin_2 (HMM E-Value=0.35) 28 8.1 >SB_33401| Best HMM Match : F5_F8_type_C (HMM E-Value=0) Length = 4277 Score = 29.1 bits (62), Expect = 3.5 Identities = 16/55 (29%), Positives = 26/55 (47%) Frame = +1 Query: 316 PASFHGSAFGRXLVLGRPLMRYLGPDN*PPPH*YSALTVLRWKVSNSNLTLLFFW 480 P ++HG R +LGR + + P PPP AL + ++ N+ +T W Sbjct: 3536 PLTWHGHISMRIELLGRRPVGPVRPPRPPPPSRLPALGMRSRRIRNNQITASSVW 3590 >SB_31403| Best HMM Match : PAN (HMM E-Value=2.7e-18) Length = 1051 Score = 28.7 bits (61), Expect = 4.7 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = -3 Query: 586 RFNKTKYYRIGDNNSTDLIVSGGGTGSNF 500 R KY IGD++ + V+GG G NF Sbjct: 912 RVTNEKYVGIGDHHGGQIAVAGGDRGHNF 940 >SB_14918| Best HMM Match : Extensin_2 (HMM E-Value=0.35) Length = 1242 Score = 27.9 bits (59), Expect = 8.1 Identities = 10/30 (33%), Positives = 17/30 (56%) Frame = -3 Query: 325 RTPEPTMCXFPRNPHEATTLRIIDPRRLEV 236 +TP P P++PH TLR+ P +++ Sbjct: 243 KTPYPIEIVDPKSPHPMGTLRLYSPHPMQI 272 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,167,200 Number of Sequences: 59808 Number of extensions: 323026 Number of successful extensions: 589 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 556 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 589 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1781448916 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -