BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0574 (700 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g49160.2 68414.m05512 protein kinase family protein contains ... 36 0.020 At1g49160.1 68414.m05511 protein kinase family protein contains ... 36 0.020 At2g40480.1 68415.m04996 expressed protein contains Pfam profile... 33 0.14 At5g56860.1 68418.m07095 zinc finger (GATA type) family protein ... 32 0.32 At3g56270.1 68416.m06253 expressed protein contains Pfam PF05701... 32 0.32 At5g61560.1 68418.m07725 protein kinase family protein contains ... 31 0.56 At4g26970.1 68417.m03881 aconitate hydratase, cytoplasmic, putat... 31 0.56 At3g18750.1 68416.m02380 protein kinase family protein contains ... 31 0.56 At3g52900.1 68416.m05830 expressed protein contains Pfam profile... 30 1.3 At2g32360.1 68415.m03955 ubiquitin family protein contains INTER... 30 1.3 At4g11560.1 68417.m01853 bromo-adjacent homology (BAH) domain-co... 29 2.2 At3g05090.2 68416.m00553 transducin family protein / WD-40 repea... 29 2.2 At3g05090.1 68416.m00552 transducin family protein / WD-40 repea... 29 2.2 At4g12020.1 68417.m01912 protein kinase family protein similar t... 29 3.0 At1g32120.1 68414.m03952 expressed protein contains Pfam profile... 29 3.0 At4g35590.1 68417.m05056 RWP-RK domain-containing protein low si... 29 3.9 At2g29210.1 68415.m03550 splicing factor PWI domain-containing p... 29 3.9 At1g69060.1 68414.m07902 expressed protein 29 3.9 At3g21350.1 68416.m02696 RNA polymerase transcriptional regulati... 28 5.2 At1g16610.2 68414.m01990 arginine/serine-rich protein, putative ... 28 5.2 At1g16610.1 68414.m01989 arginine/serine-rich protein, putative ... 28 5.2 At5g64180.1 68418.m08058 expressed protein 28 6.8 At5g15890.1 68418.m01859 expressed protein 28 6.8 At3g15355.1 68416.m01945 ubiquitin-conjugating enzyme-related si... 28 6.8 At2g40935.1 68415.m05053 expressed protein low similarity to PGP... 28 6.8 At2g36100.1 68415.m04433 integral membrane family protein contai... 28 6.8 At5g22090.1 68418.m02572 expressed protein 27 9.0 At3g15270.1 68416.m01929 squamosa promoter-binding protein-like ... 27 9.0 >At1g49160.2 68414.m05512 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 557 Score = 36.3 bits (80), Expect = 0.020 Identities = 30/83 (36%), Positives = 41/83 (49%), Gaps = 5/83 (6%) Frame = +2 Query: 224 DY*PRSCLTNQ*TRAVGMAETDSETIPNGTGPLSTEEEDERLKQRPADIDADVREMER-- 397 DY PRS ++ V D E G L EEEDERLK+ I+ RE + Sbjct: 478 DYCPRS--DDEANPTVAATTEDQEA--EKPGSLEEEEEDERLKEELEKIEERFREEMKEI 533 Query: 398 -RKRVEALMSSK--LFREELERV 457 RKR EA M +K F +++++V Sbjct: 534 TRKREEATMETKNRFFEKKMQQV 556 >At1g49160.1 68414.m05511 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 539 Score = 36.3 bits (80), Expect = 0.020 Identities = 30/83 (36%), Positives = 41/83 (49%), Gaps = 5/83 (6%) Frame = +2 Query: 224 DY*PRSCLTNQ*TRAVGMAETDSETIPNGTGPLSTEEEDERLKQRPADIDADVREMER-- 397 DY PRS ++ V D E G L EEEDERLK+ I+ RE + Sbjct: 460 DYCPRS--DDEANPTVAATTEDQEA--EKPGSLEEEEEDERLKEELEKIEERFREEMKEI 515 Query: 398 -RKRVEALMSSK--LFREELERV 457 RKR EA M +K F +++++V Sbjct: 516 TRKREEATMETKNRFFEKKMQQV 538 >At2g40480.1 68415.m04996 expressed protein contains Pfam profile PF05701: Plant protein of unknown function (DUF827); expression supported by MPSS Length = 541 Score = 33.5 bits (73), Expect = 0.14 Identities = 24/71 (33%), Positives = 39/71 (54%), Gaps = 2/71 (2%) Frame = +2 Query: 329 EEEDERLKQRPADIDAD--VREMERRKRVEALMSSKLFREELERVLDQQMHEGGDAPLLQ 502 E + +R+++ A+++ D V+E+E +EAL S+K E+L+R L Q+ D L Sbjct: 116 EFDIKRMEEHAAELEKDLIVKELETLDVLEALGSTKRIVEDLKRQLQQEALRCSD-QLSS 174 Query: 503 RIKEMVGGRLH 535 IKEM H Sbjct: 175 DIKEMNDEHCH 185 >At5g56860.1 68418.m07095 zinc finger (GATA type) family protein similar to unknown protein (pir |T04270) Length = 398 Score = 32.3 bits (70), Expect = 0.32 Identities = 19/78 (24%), Positives = 34/78 (43%), Gaps = 5/78 (6%) Frame = -3 Query: 254 DLSSKTWVSNPVARVLQESCT-----VQQMARRSDKLDDHYTQNSHTNLNGDRNRH*ARN 90 D S W+ +P R+++++ T + Q + K DHY N TN + D + Sbjct: 139 DSDSDKWLMSPKMRLIKKTITNNKQLIDQTNNNNHKESDHYPLNHKTNFDEDHHEDLNFK 198 Query: 89 IIFVKTRTYRSLYNFYST 36 + + T + N Y+T Sbjct: 199 NVLTRKTTAATTENRYNT 216 >At3g56270.1 68416.m06253 expressed protein contains Pfam PF05701: Plant protein of unknown function (DUF827) Length = 446 Score = 32.3 bits (70), Expect = 0.32 Identities = 23/78 (29%), Positives = 41/78 (52%), Gaps = 4/78 (5%) Frame = +2 Query: 329 EEEDERLKQRPADIDADV--REMERRKRVEALMSSKLFREELERVLDQQMHEGGDAP--L 496 E + +R++++ +++ D+ +E+E +EAL S+K E+L+ L QQ + P L Sbjct: 72 EFDIKRMEEQTVELEKDLIMKELETLDLLEALGSTKRIFEDLKWQLQQQALRCKETPQHL 131 Query: 497 LQRIKEMVGGRLHTGSLR 550 KEMV H L+ Sbjct: 132 RSHSKEMVDEHCHRNPLK 149 >At5g61560.1 68418.m07725 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 796 Score = 31.5 bits (68), Expect = 0.56 Identities = 23/76 (30%), Positives = 41/76 (53%), Gaps = 3/76 (3%) Frame = +2 Query: 332 EEDERLKQ---RPADIDADVREMERRKRVEALMSSKLFREELERVLDQQMHEGGDAPLLQ 502 EE RLK R + D +V EMER ++ +A ++L RE +ER ++++ A ++ Sbjct: 336 EEATRLKNLTIREEEAD-EVVEMERERQEDAENEAELVRECIERETEERLEAEARAEEVR 394 Query: 503 RIKEMVGGRLHTGSLR 550 + K+ + L G L+ Sbjct: 395 KEKQRLEDALEGGPLQ 410 >At4g26970.1 68417.m03881 aconitate hydratase, cytoplasmic, putative / citrate hydro-lyase/aconitase, putative strong similarity to SP|P49608 Aconitate hydratase, cytoplasmic (EC 4.2.1.3) (Citrate hydro-lyase) (Aconitase) {Cucurbita maxima}; contains Pfam profiles PF00330: Aconitase family (aconitate hydratase), PF00694: Aconitase C-terminal domain Length = 995 Score = 31.5 bits (68), Expect = 0.56 Identities = 18/66 (27%), Positives = 28/66 (42%) Frame = +3 Query: 330 RRKTSA*SSVRPTSTPMSAKWNAGSASKLSCPRSCSAKNWNGSSTSRCTRAATLRSCRGS 509 RR TS S + ++ + + +S P + S +N S S + + R C S Sbjct: 3 RRATSGVRSASARLSSSLSRIASSETASVSAPSASSLRNQTNRSKSFSSALRSFRVCSAS 62 Query: 510 RRWSAG 527 RWS G Sbjct: 63 TRWSHG 68 >At3g18750.1 68416.m02380 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 567 Score = 31.5 bits (68), Expect = 0.56 Identities = 20/56 (35%), Positives = 32/56 (57%), Gaps = 3/56 (5%) Frame = +2 Query: 272 GMAETDSETIPNGTGPLSTEEEDERLKQRPADIDADVREMERR---KRVEALMSSK 430 G ++ + + T P+S EEE ERL+Q +I+A +E + KR EA+M +K Sbjct: 504 GEDKSSIQEVEEATEPVSLEEE-ERLRQELEEIEAKYQEDMKEIATKREEAIMETK 558 >At3g52900.1 68416.m05830 expressed protein contains Pfam profile PF04949: Family of unknown function (DUF662) Length = 164 Score = 30.3 bits (65), Expect = 1.3 Identities = 21/60 (35%), Positives = 29/60 (48%), Gaps = 2/60 (3%) Frame = +2 Query: 305 NGTGPLSTEEEDERLKQRPADIDADVREMERRK-RVEALMSSKL-FREELERVLDQQMHE 478 NG P+ EE+E K A E+ER+K V+ + +L F EE R L Q + E Sbjct: 18 NGKLPMEDNEEEEIWKVAVTRFQAREEEIERKKMTVKEKVQQRLGFAEEATRCLTQTLEE 77 >At2g32360.1 68415.m03955 ubiquitin family protein contains INTERPRO:IPR000626 ubiquitin domain Length = 175 Score = 30.3 bits (65), Expect = 1.3 Identities = 16/43 (37%), Positives = 20/43 (46%) Frame = +2 Query: 329 EEEDERLKQRPADIDADVREMERRKRVEALMSSKLFREELERV 457 EEED+ +K D D V E E K E +K +EE V Sbjct: 124 EEEDQAMKDEEEDRDVKVEEDEEEKEKEKDGEAKYVKEEAREV 166 >At4g11560.1 68417.m01853 bromo-adjacent homology (BAH) domain-containing protein contains Pfam profile PF01426: BAH domain Length = 587 Score = 29.5 bits (63), Expect = 2.2 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +2 Query: 275 MAETDSETIPNGTGPLSTEEEDERLKQRPAD 367 MAE D + T P + EEEDE +++P D Sbjct: 70 MAEGDDDQAEEETNPEAEEEEDEEEEEKPDD 100 >At3g05090.2 68416.m00553 transducin family protein / WD-40 repeat family protein contains seven G-protein beta WD-40 repeats; similar to uncharacterized KIAA1449 protein (gi:7959157) [Homo sapiens] Length = 753 Score = 29.5 bits (63), Expect = 2.2 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = +3 Query: 396 AGSASKLSCPRSCSAKNWNGSSTSRCTRAATLR 494 AG ++ +SC + K W+G S CTR TLR Sbjct: 93 AGESTLVSCSSDTTVKTWDGLSDGVCTR--TLR 123 >At3g05090.1 68416.m00552 transducin family protein / WD-40 repeat family protein contains seven G-protein beta WD-40 repeats; similar to uncharacterized KIAA1449 protein (gi:7959157) [Homo sapiens] Length = 753 Score = 29.5 bits (63), Expect = 2.2 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = +3 Query: 396 AGSASKLSCPRSCSAKNWNGSSTSRCTRAATLR 494 AG ++ +SC + K W+G S CTR TLR Sbjct: 93 AGESTLVSCSSDTTVKTWDGLSDGVCTR--TLR 123 >At4g12020.1 68417.m01912 protein kinase family protein similar to mitogen-activated protein kinase [Arabidopsis thaliana] GI:1255448; contains Pfam profiles PF02671: Paired amphipathic helix repeat, PF03106: WRKY DNA-binding domain, PF00560: Leucine Rich Repeat, PF00069: Protein kinase domain, PF00931: NB-ARC domain Length = 1798 Score = 29.1 bits (62), Expect = 3.0 Identities = 15/49 (30%), Positives = 24/49 (48%) Frame = +3 Query: 366 TSTPMSAKWNAGSASKLSCPRSCSAKNWNGSSTSRCTRAATLRSCRGSR 512 +S P S +N + +L+ P SC+ K W G CT ++L + R Sbjct: 1218 SSLPKS--FNPENLVELNLPSSCAKKLWKGKKARFCTTNSSLEKLKKMR 1264 >At1g32120.1 68414.m03952 expressed protein contains Pfam profile PF04819: Family of unknown function (DUF716) (Plant viral-response family) Length = 1206 Score = 29.1 bits (62), Expect = 3.0 Identities = 23/85 (27%), Positives = 39/85 (45%) Frame = +3 Query: 273 EWLRRTQRRSRTAPDPCPPRRKTSA*SSVRPTSTPMSAKWNAGSASKLSCPRSCSAKNWN 452 EW++R+ R + +PD + SS R T +P + N + S PRS + + Sbjct: 570 EWVQRSSHRPKKSPDRSSDEPEWVETSSARSTKSPARSSDNLKWVQR-SSPRSTKSPD-- 626 Query: 453 GSSTSRCTRAATLRSCRGSRRWSAG 527 S+ R A ++ +G+ R S G Sbjct: 627 -RSSGRA--ADDVKDLKGALRGSGG 648 >At4g35590.1 68417.m05056 RWP-RK domain-containing protein low similarity to minus dominance protein [Chlamydomonas reinhardtii] GI:1928929; contains Pfam profile: PF02042 RWP-RK domain Length = 370 Score = 28.7 bits (61), Expect = 3.9 Identities = 21/77 (27%), Positives = 35/77 (45%) Frame = +2 Query: 233 PRSCLTNQ*TRAVGMAETDSETIPNGTGPLSTEEEDERLKQRPADIDADVREMERRKRVE 412 PR + Q + +ET+SE N S E D K ++ DA ++++KR Sbjct: 179 PRKLVLKQDLNCLPDSETESEESVNEKTEHSEFEND---KTEQSESDAKTEILKKKKRTP 235 Query: 413 ALMSSKLFREELERVLD 463 + ++L EEL + D Sbjct: 236 SRHVAELSLEELSKYFD 252 >At2g29210.1 68415.m03550 splicing factor PWI domain-containing protein contains Pfam profile PF01480: PWI domain Length = 878 Score = 28.7 bits (61), Expect = 3.9 Identities = 19/47 (40%), Positives = 24/47 (51%), Gaps = 3/47 (6%) Frame = +1 Query: 307 RHRTPVHRGGRRALEAASG--RHRRRCPRNG-TPEARRSSHVLEAVP 438 R TPV+R RR+ A+ R RRR P + +P RS VL P Sbjct: 584 RSPTPVNRRSRRSSSASRSPDRRRRRSPSSSRSPSRSRSPPVLHRSP 630 Score = 27.5 bits (58), Expect = 9.0 Identities = 19/45 (42%), Positives = 21/45 (46%), Gaps = 5/45 (11%) Frame = +1 Query: 292 RDDPERHRTPVHRGGRRALEAASGRHRRRCP-----RNGTPEARR 411 R RHR P H GRR A S R R P R+ +P ARR Sbjct: 286 RSPIRRHRRPTHE-GRRQSPAPSRRRRSPSPPARRRRSPSPPARR 329 >At1g69060.1 68414.m07902 expressed protein Length = 630 Score = 28.7 bits (61), Expect = 3.9 Identities = 24/87 (27%), Positives = 46/87 (52%), Gaps = 1/87 (1%) Frame = +2 Query: 329 EEEDERLKQRPADIDADVREMER-RKRVEALMSSKLFREELERVLDQQMHEGGDAPLLQR 505 +EE+ +QR I AD + +R R+++E + ++ R + ERV + + + D + Sbjct: 480 QEEEWESRQRQLQIQADEAQKQRKRRKLENMRKLEMERRQKERVEEVRETQKKDEENM-N 538 Query: 506 IKEMVGGRLHTGSLRVWLRCSYLYAAV 586 +KE V + T SL++ S+ AA+ Sbjct: 539 MKEKVRAEI-TKSLKLLELKSFNMAAL 564 >At3g21350.1 68416.m02696 RNA polymerase transcriptional regulation mediator-related contains weak similarity to RNA polymerase transcriptional regulation mediator, subunit 6 homolog (Activator-recruited cofactor 33 kDa component) (ARC33) (NY-REN-28 antigen) (Swiss-Prot:O75586) [Homo sapiens] Length = 257 Score = 28.3 bits (60), Expect = 5.2 Identities = 17/58 (29%), Positives = 33/58 (56%) Frame = +2 Query: 269 VGMAETDSETIPNGTGPLSTEEEDERLKQRPADIDADVREMERRKRVEALMSSKLFRE 442 + A TD+ + + TE ++E + +PA D++EM KRV+ +++S L+R+ Sbjct: 152 ISKAFTDAASKLETIRQVDTENQNEPAESKPASETVDLKEM---KRVDVILTS-LYRK 205 >At1g16610.2 68414.m01990 arginine/serine-rich protein, putative (SR45) similar to arginine/serine-rich protein GI:6601502 from [Arabidopsis thaliana] Length = 407 Score = 28.3 bits (60), Expect = 5.2 Identities = 25/83 (30%), Positives = 37/83 (44%), Gaps = 3/83 (3%) Frame = -3 Query: 437 GTASRT*ELRRASGVPFRG-HRRRCRPDAASSARLPPRW--TGVRCRSGSSLSPSQPFRQ 267 G++SR+ R+ P R R R R + SS+ P R +G R SP+ P R+ Sbjct: 15 GSSSRSSSRSRSGSSPSRSISRSRSRSRSLSSSSSPSRSVSSGSRSPPRRGKSPAGPARR 74 Query: 266 LESIDLSSKTWVSNPVARVLQES 198 S S+P + +QES Sbjct: 75 GRSPPPPPSKGASSPSKKAVQES 97 >At1g16610.1 68414.m01989 arginine/serine-rich protein, putative (SR45) similar to arginine/serine-rich protein GI:6601502 from [Arabidopsis thaliana] Length = 414 Score = 28.3 bits (60), Expect = 5.2 Identities = 25/83 (30%), Positives = 37/83 (44%), Gaps = 3/83 (3%) Frame = -3 Query: 437 GTASRT*ELRRASGVPFRG-HRRRCRPDAASSARLPPRW--TGVRCRSGSSLSPSQPFRQ 267 G++SR+ R+ P R R R R + SS+ P R +G R SP+ P R+ Sbjct: 15 GSSSRSSSRSRSGSSPSRSISRSRSRSRSLSSSSSPSRSVSSGSRSPPRRGKSPAGPARR 74 Query: 266 LESIDLSSKTWVSNPVARVLQES 198 S S+P + +QES Sbjct: 75 GRSPPPPPSKGASSPSKKAVQES 97 >At5g64180.1 68418.m08058 expressed protein Length = 158 Score = 27.9 bits (59), Expect = 6.8 Identities = 25/106 (23%), Positives = 45/106 (42%), Gaps = 4/106 (3%) Frame = +2 Query: 236 RSCLTNQ*TRAVGMAETDSETIPNGTGPLSTEEEDERLKQRPADID---ADVREMERRKR 406 R+ L ++ R + + E +T+ T R ++R A+ A+ R + K Sbjct: 47 RASLVSEQARTIKVLEQRVQTLERELDAAITAAAHARSEKRQAESSQKAAESRAQDVTKE 106 Query: 407 VEALMSS-KLFREELERVLDQQMHEGGDAPLLQRIKEMVGGRLHTG 541 +E KL EEL + +Q + LL+ I + +GG+ G Sbjct: 107 LENTTKVFKLHMEELRGMQEQISKRDNEIKLLEAIIQTLGGKERLG 152 >At5g15890.1 68418.m01859 expressed protein Length = 526 Score = 27.9 bits (59), Expect = 6.8 Identities = 14/37 (37%), Positives = 19/37 (51%) Frame = +3 Query: 309 APDPCPPRRKTSA*SSVRPTSTPMSAKWNAGSASKLS 419 +P P PP R +SA S P + P+ A N S L+ Sbjct: 125 SPVPAPPHRNSSADQSPSPVNGPIPAPLNHTSLRHLN 161 >At3g15355.1 68416.m01945 ubiquitin-conjugating enzyme-related similar to ubiquitin-conjugating enzyme (GI:3319990) [Mus musculus]; similar to Baculoviral IAP repeat-containing protein 6 (Ubiquitin-conjugating BIR-domain enzyme apollon) (Swiss-Prot:Q9NR09) [Homo sapiens]; Length = 609 Score = 27.9 bits (59), Expect = 6.8 Identities = 21/70 (30%), Positives = 35/70 (50%), Gaps = 1/70 (1%) Frame = +3 Query: 363 PTSTPMSAKWNAGSASKLSCPRSCSAKNWNGSSTS-RCTRAATLRSCRGSRRWSAGDCTP 539 PT +S W SA K S S S+ NG+++S + T+A+ + S ++S+ TP Sbjct: 137 PTGVEVSMDWFPNSADKESASSSKSSHANNGNNSSKKATKASGIHS-----QFSSDMETP 191 Query: 540 EASGYGCVVH 569 A + + H Sbjct: 192 VAQPWNALPH 201 >At2g40935.1 68415.m05053 expressed protein low similarity to PGPS/D12 [Petunia x hybrida] GI:4105794; contains Pfam profile PF04749: Protein of unknown function, DUF614 Length = 190 Score = 27.9 bits (59), Expect = 6.8 Identities = 13/40 (32%), Positives = 20/40 (50%), Gaps = 5/40 (12%) Frame = +2 Query: 98 LSACYDRRSNLCVNFVCSDHLICRYA-----GPSAGPCMT 202 + AC+D + CV C ++ + A G AGPC+T Sbjct: 51 ICACFDDMQSCCVGLFCPCYIFGKNAELLGSGTFAGPCLT 90 >At2g36100.1 68415.m04433 integral membrane family protein contains TIGRFAM TIGR01569 : plant integral membrane protein TIGR01569; contains Pfam PF04535 : Domain of unknown function (DUF588) Length = 206 Score = 27.9 bits (59), Expect = 6.8 Identities = 15/40 (37%), Positives = 20/40 (50%) Frame = -1 Query: 484 AALVHLLVEDPFQFFAEQLRGHESFDALPAFHFADIGVDV 365 AA V E+ FF + L+ +D LPAF + I V V Sbjct: 63 AASVMYTAEETLPFFTQFLQFQAGYDDLPAFQYFVIAVAV 102 >At5g22090.1 68418.m02572 expressed protein Length = 463 Score = 27.5 bits (58), Expect = 9.0 Identities = 13/24 (54%), Positives = 16/24 (66%) Frame = -3 Query: 299 SSLSPSQPFRQLESIDLSSKTWVS 228 S+ S + R+ S DLSSKTWVS Sbjct: 31 SNTSSAPSLRRTFSADLSSKTWVS 54 >At3g15270.1 68416.m01929 squamosa promoter-binding protein-like 5 (SPL5) identical to squamosa promoter binding protein-like 5 [Arabidopsis thaliana] GI:5931629; contains Pfam profile PF03110: SBP domain Length = 181 Score = 27.5 bits (58), Expect = 9.0 Identities = 12/34 (35%), Positives = 19/34 (55%) Frame = +2 Query: 425 SKLFREELERVLDQQMHEGGDAPLLQRIKEMVGG 526 S L EE+E +D + +GGD +++ E V G Sbjct: 19 SNLVEEEMENGMDGEEEDGGDEDKRKKVMERVRG 52 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,110,172 Number of Sequences: 28952 Number of extensions: 273846 Number of successful extensions: 1170 Number of sequences better than 10.0: 28 Number of HSP's better than 10.0 without gapping: 1100 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1163 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1496852856 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -