BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0572 (750 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439060-4|CAD27755.1| 151|Anopheles gambiae putative sRNP prot... 28 0.35 AB097148-2|BAC82628.1| 1077|Anopheles gambiae pol-like protein p... 25 3.3 AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine pr... 24 5.8 AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22... 24 5.8 AJ438610-1|CAD27473.1| 838|Anopheles gambiae putative microtubu... 21 6.1 AY263177-1|AAP78792.1| 699|Anopheles gambiae TmcC-like protein ... 23 7.6 >AJ439060-4|CAD27755.1| 151|Anopheles gambiae putative sRNP protein. Length = 151 Score = 27.9 bits (59), Expect = 0.35 Identities = 20/56 (35%), Positives = 30/56 (53%) Frame = -3 Query: 493 TLPKPWTMNVLPPQPGVVPIMLM*LASLMKFSKPWNTPLPVAETLPWMPPWLIGLP 326 ++P P TMN +PP+PG++P M LM + P P+ P M P +G+P Sbjct: 77 SIPPP-TMN-MPPRPGMIPGMPGAPPLLMGPNGPLPPPMMGMRPPPMMVP-TMGMP 129 >AB097148-2|BAC82628.1| 1077|Anopheles gambiae pol-like protein protein. Length = 1077 Score = 24.6 bits (51), Expect = 3.3 Identities = 23/93 (24%), Positives = 40/93 (43%), Gaps = 2/93 (2%) Frame = +1 Query: 82 WTCLSAVLRPVSRSIPKNTPSMNWKRSLVVSPLNLPKKDSLGLAWMSPLLTWVPANEKCL 261 + CL V++ + P T + W R + L L K SL ++ L W + CL Sbjct: 894 YPCLRIVIQQLGYQPPSATITTRWIRQTMTEVL-LEPKVSLENPSVNWRLLWRNIHRSCL 952 Query: 262 GSPILMRRPSVF--KTSTLTPASLANLLTRVAS 354 S ++R ++F ++ L + + RV S Sbjct: 953 SS---LQRSTLFLLVNGKISHGELLHRMNRVPS 982 >AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine protease protein. Length = 1322 Score = 23.8 bits (49), Expect = 5.8 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = +2 Query: 647 ALRPTKAXTCFTXSATXLYPXPFEQVI 727 AL TK T T + T P P QVI Sbjct: 569 ALNTTKLSTMMTTTTTTTEPPPIVQVI 595 >AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22D protein. Length = 1322 Score = 23.8 bits (49), Expect = 5.8 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = +2 Query: 647 ALRPTKAXTCFTXSATXLYPXPFEQVI 727 AL TK T T + T P P QVI Sbjct: 568 ALNTTKLSTMMTTTTTTTEPPPIVQVI 594 >AJ438610-1|CAD27473.1| 838|Anopheles gambiae putative microtubule binding protein protein. Length = 838 Score = 21.0 bits (42), Expect(2) = 6.1 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = +3 Query: 354 HGRVSATGRGVFHGLENFINE 416 H S+ GR H L++FIN+ Sbjct: 418 HELDSSGGRPPLHALKDFINK 438 Score = 20.6 bits (41), Expect(2) = 6.1 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = +3 Query: 219 VPAPDMGTGEREMS 260 +P P G GERE S Sbjct: 387 MPGPGPGIGEREKS 400 >AY263177-1|AAP78792.1| 699|Anopheles gambiae TmcC-like protein protein. Length = 699 Score = 23.4 bits (48), Expect = 7.6 Identities = 12/27 (44%), Positives = 19/27 (70%) Frame = +1 Query: 265 SPILMRRPSVFKTSTLTPASLANLLTR 345 SP+ + + S+F+T L +SLA LL+R Sbjct: 295 SPLFVIKISLFRTVFLRLSSLAVLLSR 321 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 719,773 Number of Sequences: 2352 Number of extensions: 15376 Number of successful extensions: 33 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 29 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 33 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 77339358 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -