BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0568 (750 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_04_0180 + 20696258-20698398,20698691-20698871,20698998-20699060 30 2.3 09_06_0343 - 22415525-22415833,22415999-22416134,22416593-224166... 28 6.9 >02_04_0180 + 20696258-20698398,20698691-20698871,20698998-20699060 Length = 794 Score = 29.9 bits (64), Expect = 2.3 Identities = 18/47 (38%), Positives = 28/47 (59%), Gaps = 1/47 (2%) Frame = -3 Query: 307 EDECFRTSDKLYGDKKLILKYLQNYARA-TCMRFSRSYNM*DSIQYQ 170 +DE T + L+GD++ +LKY + YA+A T R SR S+Q + Sbjct: 338 DDEVANTENNLHGDERNLLKYCE-YAKAPTKRRSSRPQRNAASVQIE 383 >09_06_0343 - 22415525-22415833,22415999-22416134,22416593-22416697, 22417696-22418291 Length = 381 Score = 28.3 bits (60), Expect = 6.9 Identities = 15/39 (38%), Positives = 21/39 (53%) Frame = -3 Query: 187 DSIQYQHVQCNYTACRDAVTSRSQHWRKP*RHGTDGRAP 71 +S+Q +HV+ + A R AVT R P +GT G P Sbjct: 300 ESLQREHVEEHKAALRRAVTLSVPDARSPSAYGTFGEQP 338 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,194,762 Number of Sequences: 37544 Number of extensions: 456208 Number of successful extensions: 962 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 937 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 961 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1992480932 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -