BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0568 (750 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_14898| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_48457| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.0 SB_37708| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.0 >SB_14898| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 649 Score = 29.9 bits (64), Expect = 2.3 Identities = 37/140 (26%), Positives = 56/140 (40%) Frame = +3 Query: 15 LHFSPDYYPQTLSRQSKVIGARPSVP*RHGLRQCCDRDVTASRHAV*LHCTC*YCIESHI 194 +H S P LSRQ++V P V +GLR R + SR + T ES Sbjct: 451 VHVSDSDLPSGLSRQTEVSPLSPKVDPSNGLRPTVQRSKSFSRTKI-ERVTTTMGQESGF 509 Query: 195 L*LRLNLMQVALA*FCKYFNISFLSP*SLSLVRKHSSSALATRGDTNFKSHDFFFLLKEI 374 L+ L F KY + L + +R +S + + F S+ F +L Sbjct: 510 GEFMLSFSDKELLEFYKYEIDAQLFVLN-EAMRGLFNSVESGQPPKTFVSNSKFVVLSAH 568 Query: 375 *FYLFVDTNRMRVHASRLGV 434 F DT ++H +LG+ Sbjct: 569 KFIYIGDTLHRKIHHDKLGI 588 >SB_48457| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 28.3 bits (60), Expect = 7.0 Identities = 12/44 (27%), Positives = 27/44 (61%) Frame = +3 Query: 591 QSTVDPMSRSSTCNLFNFHPPH*QLVITNVECTPHFNSNSGSRS 722 +++ SR+ ++ F+PP+ + V TN+E + ++SG+R+ Sbjct: 59 RTSTQRQSRNRQRDVIWFNPPYSKNVSTNIEFNRQYRNSSGNRT 102 >SB_37708| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1926 Score = 28.3 bits (60), Expect = 7.0 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = +1 Query: 382 ICLSTQIV*GYTPVDWASACKVSVLVVHSTRCDHIV 489 + ++T V P+ A AC V VLVV C H+V Sbjct: 893 VAMATGSVSVALPIGIAGACAVLVLVVFGLTCRHVV 928 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,404,024 Number of Sequences: 59808 Number of extensions: 525480 Number of successful extensions: 1319 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1266 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1318 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2034222073 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -