BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0567 (400 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY569781-1|AAS75781.1| 461|Apis mellifera neuronal nicotinic ac... 23 1.7 Y13429-1|CAA73841.1| 402|Apis mellifera dopamine receptor, D1 p... 21 3.9 AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 21 3.9 >AY569781-1|AAS75781.1| 461|Apis mellifera neuronal nicotinic acetylcholine Apisa7-2 subunit protein. Length = 461 Score = 22.6 bits (46), Expect = 1.7 Identities = 8/23 (34%), Positives = 14/23 (60%) Frame = -3 Query: 158 EFSVVAIINLPLNSVYRQNNYYY 90 EF+ + +I +P N V+R + Y Sbjct: 73 EFAGIRVIRVPYNRVWRPDTILY 95 >Y13429-1|CAA73841.1| 402|Apis mellifera dopamine receptor, D1 protein. Length = 402 Score = 21.4 bits (43), Expect = 3.9 Identities = 11/34 (32%), Positives = 17/34 (50%) Frame = +1 Query: 202 ECSVSRHSRCQSRRHGQAVACRAFFRSSFEACVI 303 EC R Q +R+G + C RSS ++C + Sbjct: 355 ECGEFRSVVVQ-KRNGSMIECNISPRSSADSCQV 387 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 21.4 bits (43), Expect = 3.9 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = -1 Query: 397 HVKIIMYTGCXIFLSXKXLH 338 H+ MYT C I+L+ L+ Sbjct: 849 HIGFTMYTTCVIWLAFVPLY 868 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 100,476 Number of Sequences: 438 Number of extensions: 1770 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 52 effective length of database: 123,567 effective search space used: 9885360 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -