BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0566 (644 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g15200.1 68418.m01781 40S ribosomal protein S9 (RPS9B) 40S ri... 275 1e-74 At5g39850.1 68418.m04829 40S ribosomal protein S9 (RPS9C) 40S ri... 275 2e-74 At5g15750.1 68418.m01842 RNA-binding S4 domain-containing protei... 45 5e-05 At5g01850.1 68418.m00104 protein kinase, putative similar to pro... 30 1.1 At1g24490.1 68414.m03084 60 kDa inner membrane family protein si... 29 3.5 At5g67320.1 68418.m08490 WD-40 repeat family protein strong simi... 28 4.6 At1g43730.1 68414.m05028 hypothetical protein 28 4.6 At5g41310.1 68418.m05020 kinesin motor protein-related 27 8.1 At5g41240.1 68418.m05011 glutathione S-transferase, putative sim... 27 8.1 At5g28615.1 68418.m03493 hypothetical protein 27 8.1 At4g32190.1 68417.m04581 centromeric protein-related low similar... 27 8.1 >At5g15200.1 68418.m01781 40S ribosomal protein S9 (RPS9B) 40S ribosomal protein S9, Chlamydomonas sp., EMBL:AU066528 Length = 198 Score = 275 bits (675), Expect = 1e-74 Identities = 126/169 (74%), Positives = 151/169 (89%) Frame = +3 Query: 33 FSKTYVTPRRPFEKARLDQELKIIGEYGLRNKREVWRVKYTLARIRKAARELLTLEEKDP 212 + KT+ PRRP+EK RLD ELK++GEYGLRNKRE+WRV+Y+L+RIR AAR+LLTL+EK P Sbjct: 10 YGKTFKGPRRPYEKERLDSELKLVGEYGLRNKRELWRVQYSLSRIRNAARDLLTLDEKSP 69 Query: 213 KRLFEGNALLRRLVRIGVLDEKQMKLDYVLGLKIEDFLERRLQTQVFKAGLAKSIHHARI 392 +R+FEG ALLRR+ R G+LDE Q KLDYVL L +E+FLERRLQT VFK+G+AKSIHH+R+ Sbjct: 70 RRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTIVFKSGMAKSIHHSRV 129 Query: 393 LIRQRHIRVRKQVVNIPSFIVRLDSGKHIDFSLKSPFGGGRPGRVKRKN 539 LIRQRHIRV KQ+VNIPSF+VRLDS KHIDF+L SPFGGGRPGRVKR+N Sbjct: 130 LIRQRHIRVGKQLVNIPSFMVRLDSQKHIDFALTSPFGGGRPGRVKRRN 178 >At5g39850.1 68418.m04829 40S ribosomal protein S9 (RPS9C) 40S ribosomal protein S9 - Chlamydomonas sp.,EMBL:AU066528 Length = 197 Score = 275 bits (674), Expect = 2e-74 Identities = 129/179 (72%), Positives = 155/179 (86%) Frame = +3 Query: 9 VNNRVPSVFSKTYVTPRRPFEKARLDQELKIIGEYGLRNKREVWRVKYTLARIRKAAREL 188 VN R + KT+ PRRP+EK RLD ELK++GEYGLR KRE+WRV+YTL+RIR AAREL Sbjct: 2 VNVRFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYTLSRIRNAAREL 61 Query: 189 LTLEEKDPKRLFEGNALLRRLVRIGVLDEKQMKLDYVLGLKIEDFLERRLQTQVFKAGLA 368 LTL+EK+P+R+FEG ALLRR+ R G+LDE Q KLDYVL L +E+FLERRLQT VFK+G+A Sbjct: 62 LTLDEKNPRRIFEGEALLRRMNRYGLLDETQNKLDYVLALTVENFLERRLQTIVFKSGMA 121 Query: 369 KSIHHARILIRQRHIRVRKQVVNIPSFIVRLDSGKHIDFSLKSPFGGGRPGRVKRKNLR 545 KSIHHAR+LIRQRHIRV +Q+VNIPSF+VR++S KH+DFSL SPFGGGRPGRVKR+N R Sbjct: 122 KSIHHARVLIRQRHIRVGRQLVNIPSFMVRVESQKHVDFSLTSPFGGGRPGRVKRRNER 180 >At5g15750.1 68418.m01842 RNA-binding S4 domain-containing protein 40S RIBOSOMAL PROTEINs - different species Length = 182 Score = 44.8 bits (101), Expect = 5e-05 Identities = 29/123 (23%), Positives = 56/123 (45%) Frame = +3 Query: 87 QELKIIGEYGLRNKREVWRVKYTLARIRKAARELLTLEEKDPKRLFEGNALLRRLVRIGV 266 +E +I Y + ++ + + ++K + ++ DP R+ + LL +L +GV Sbjct: 27 RENEITYRYHMGSRDDYKKYSGLCRMVQKLTNIMKQMDPADPFRIQMTDMLLEKLYNMGV 86 Query: 267 LDEKQMKLDYVLGLKIEDFLERRLQTQVFKAGLAKSIHHARILIRQRHIRVRKQVVNIPS 446 + ++ L L + F RRL T + A+ A I Q H+RV + + P+ Sbjct: 87 IPTRK-SLTLTERLSVSSFCRRRLSTVLVHLKFAEHHKEAVTYIEQGHVRVGPETITDPA 145 Query: 447 FIV 455 F+V Sbjct: 146 FLV 148 >At5g01850.1 68418.m00104 protein kinase, putative similar to protein kinase [Arabidopsis thaliana] gi|1054633|emb|CAA63387; contains protein kinase domain, Pfam:PF00069 Length = 333 Score = 30.3 bits (65), Expect = 1.1 Identities = 13/21 (61%), Positives = 17/21 (80%) Frame = -1 Query: 512 TSXEWRFQREVNVLARVQAHN 450 +S E RF REVN+++RVQ HN Sbjct: 57 SSLESRFVREVNMMSRVQHHN 77 >At1g24490.1 68414.m03084 60 kDa inner membrane family protein similar to chloroplast membrane protein (ALBINO3) (GI:3927828) [Arabidopsis thaliana] Length = 1013 Score = 28.7 bits (61), Expect = 3.5 Identities = 16/41 (39%), Positives = 20/41 (48%), Gaps = 2/41 (4%) Frame = +3 Query: 39 KTYVTPRR-PFEKARLDQ-ELKIIGEYGLRNKREVWRVKYT 155 K ++ PRR P + Q E K EYG RN E W + T Sbjct: 479 KYFIKPRRHPESECSATQTEYKFTSEYGKRNSSECWAMTTT 519 >At5g67320.1 68418.m08490 WD-40 repeat family protein strong similarity to unknown protein (ref|NP_005638.1) Length = 613 Score = 28.3 bits (60), Expect = 4.6 Identities = 12/28 (42%), Positives = 14/28 (50%) Frame = +2 Query: 278 TDETRLCAWSED*GLLGASSADAGVQSW 361 T E CAWS LL + S DA + W Sbjct: 265 TSEVCACAWSPSASLLASGSGDATARIW 292 >At1g43730.1 68414.m05028 hypothetical protein Length = 320 Score = 28.3 bits (60), Expect = 4.6 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = -3 Query: 396 SKFWHDGWTSPGQL 355 +KFWHD WT G L Sbjct: 77 AKFWHDNWTGHGPL 90 >At5g41310.1 68418.m05020 kinesin motor protein-related Length = 961 Score = 27.5 bits (58), Expect = 8.1 Identities = 15/36 (41%), Positives = 19/36 (52%) Frame = +1 Query: 340 RRRCSKLAWRSPSIMPEF*SGKGIFVSASKL*TSHH 447 RRR S A S + F G F+ AS++ TSHH Sbjct: 141 RRRWSLPADHSKGVDSNFNDGGSQFIEASEINTSHH 176 >At5g41240.1 68418.m05011 glutathione S-transferase, putative similar to glutathione S-transferase, GST 10b GB:CAA10662 [Arabidopsis thaliana] 37349. Length = 591 Score = 27.5 bits (58), Expect = 8.1 Identities = 13/34 (38%), Positives = 21/34 (61%) Frame = +3 Query: 246 RLVRIGVLDEKQMKLDYVLGLKIEDFLERRLQTQ 347 RL + VLDE++ +D LG+K ER++ T+ Sbjct: 473 RLENLWVLDEEEQVMDLPLGVKSSKQKERKVATK 506 >At5g28615.1 68418.m03493 hypothetical protein Length = 149 Score = 27.5 bits (58), Expect = 8.1 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = -3 Query: 396 SKFWHDGWTSPGQL 355 +KFWHD WT G L Sbjct: 9 AKFWHDDWTGLGPL 22 >At4g32190.1 68417.m04581 centromeric protein-related low similarity to SP|Q02224 Centromeric protein E (CENP-E protein) {Homo sapiens} Length = 783 Score = 27.5 bits (58), Expect = 8.1 Identities = 14/48 (29%), Positives = 25/48 (52%) Frame = +3 Query: 108 EYGLRNKREVWRVKYTLARIRKAARELLTLEEKDPKRLFEGNALLRRL 251 +YG+ NKR V + +T +R E+L ++ + E N ++ RL Sbjct: 599 DYGMENKRLVMELSFTRENLRMKEMEVLAVQRALTFKDEEINVVMGRL 646 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,285,162 Number of Sequences: 28952 Number of extensions: 253152 Number of successful extensions: 777 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 746 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 767 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1334473344 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -