BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0560 (650 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC6G9.12 |cfr1||Chs five related protein Cfr1|Schizosaccharomy... 29 0.77 SPBC1778.03c |||NADH pyrophosphatase |Schizosaccharomyces pombe|... 27 2.3 SPAC2F7.11 |nrd1|msa2|RNA-binding protein Nrd1|Schizosaccharomyc... 25 9.5 >SPAC6G9.12 |cfr1||Chs five related protein Cfr1|Schizosaccharomyces pombe|chr 1|||Manual Length = 620 Score = 28.7 bits (61), Expect = 0.77 Identities = 16/50 (32%), Positives = 24/50 (48%) Frame = +1 Query: 346 EEKPQTESEVLATSENPKPTESAAPLSDVXIKSDTPHNKEASVNKQKRPQ 495 E+ S++ S++ KP E AP S IK+D P N N ++ Q Sbjct: 336 EQSIDVSSDIGLRSDSSKPNE--APTSSENIKADQPENSTKQENPEEDMQ 383 >SPBC1778.03c |||NADH pyrophosphatase |Schizosaccharomyces pombe|chr 2|||Manual Length = 376 Score = 27.1 bits (57), Expect = 2.3 Identities = 15/44 (34%), Positives = 20/44 (45%) Frame = -1 Query: 326 TIGGFGFCCCN*LIPSDSNSSCKSGIADNNDSANDSAGIMAMTS 195 T+GG C + L+ DSN K GI + D IM + S Sbjct: 192 TMGGTKLVCSDVLLNDDSNCPSKKGINNYQYPRTDPCVIMVILS 235 >SPAC2F7.11 |nrd1|msa2|RNA-binding protein Nrd1|Schizosaccharomyces pombe|chr 1|||Manual Length = 529 Score = 25.0 bits (52), Expect = 9.5 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = -2 Query: 139 PYSQN*VELPQRAPITRPTPLPHTL 65 P SQ+ + +P R P P +PHT+ Sbjct: 6 PSSQSRLSVPGRTPHLPPLTIPHTV 30 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,120,075 Number of Sequences: 5004 Number of extensions: 35370 Number of successful extensions: 105 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 101 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 105 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 293780908 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -