BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0559 (700 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g14780.1 68417.m02273 protein kinase, putative similar to pro... 29 2.2 At3g22750.1 68416.m02869 protein kinase, putative similar to pro... 29 3.0 At3g56480.1 68416.m06281 myosin heavy chain-related contains wea... 29 3.9 At2g25280.1 68415.m03024 expressed protein 29 3.9 At1g04430.1 68414.m00434 dehydration-responsive protein-related ... 29 3.9 At4g15490.1 68417.m02367 UDP-glucoronosyl/UDP-glucosyl transfera... 28 5.2 At3g63260.2 68416.m07109 protein kinase, putative (MRK1) identic... 28 5.2 At3g63260.1 68416.m07108 protein kinase, putative (MRK1) identic... 28 5.2 At5g13520.1 68418.m01561 peptidase M1 family protein similar to ... 28 6.8 At5g04360.1 68418.m00428 pullulanase, putative / starch debranch... 28 6.8 At4g15500.1 68417.m02368 UDP-glucoronosyl/UDP-glucosyl transfera... 28 6.8 At3g49830.1 68416.m05448 DNA helicase-related similar to DNA hel... 28 6.8 At5g41830.1 68418.m05093 F-box family protein-related contains a... 27 9.0 At1g43760.1 68414.m05034 hypothetical protein 27 9.0 >At4g14780.1 68417.m02273 protein kinase, putative similar to protein kinase ATMRK1 [Arabidopsis thaliana] gi|2351097|dbj|BAA22079 Length = 364 Score = 29.5 bits (63), Expect = 2.2 Identities = 15/42 (35%), Positives = 20/42 (47%) Frame = +1 Query: 145 SDFGVASTRATKLRRTYIETPAFEEKKVTVVEGKPFELRCPV 270 +DFGVA A + ET V++GKP+ RC V Sbjct: 223 ADFGVARVEALNPKDMTGETGTLGYMAPEVIDGKPYNRRCDV 264 >At3g22750.1 68416.m02869 protein kinase, putative similar to protein kinase ATMRK1 [Arabidopsis thaliana] gi|2351097|dbj|BAA22079 Length = 378 Score = 29.1 bits (62), Expect = 3.0 Identities = 18/50 (36%), Positives = 24/50 (48%), Gaps = 1/50 (2%) Frame = +1 Query: 124 EYQCFAK-SDFGVASTRATKLRRTYIETPAFEEKKVTVVEGKPFELRCPV 270 +YQ K +DFGVA A + ET V++GKP+ RC V Sbjct: 229 DYQRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPEVLDGKPYNRRCDV 278 >At3g56480.1 68416.m06281 myosin heavy chain-related contains weak similarity to Myosin heavy chain, cardiac muscle alpha isoform (MyHC-alpha) (Alpha isomyosin) (Fragment) (Swiss-Prot:P04460) [Oryctolagus cuniculus] Length = 490 Score = 28.7 bits (61), Expect = 3.9 Identities = 16/46 (34%), Positives = 25/46 (54%), Gaps = 1/46 (2%) Frame = -2 Query: 618 AKGSSAINAV*IRQIANFRHHVVTQVLRDQLS-IRGLRGGSHLRDV 484 A S N +R++A+ HV+ + LRD L +RG G + +DV Sbjct: 86 AAAVSLANEAKLREVASLEGHVMLKKLRDALEYMRGRTDGQNKQDV 131 >At2g25280.1 68415.m03024 expressed protein Length = 291 Score = 28.7 bits (61), Expect = 3.9 Identities = 12/29 (41%), Positives = 18/29 (62%) Frame = +1 Query: 466 VPVVTYYITQVTPASEPTYGELIPQYLSD 552 V VV + V+P +E YGEL+ +Y+ D Sbjct: 147 VKVVPILVGAVSPENEAMYGELLAKYVDD 175 >At1g04430.1 68414.m00434 dehydration-responsive protein-related similar to early-responsive to dehydration stress ERD3 protein [Arabidopsis thaliana] GI:15320410; contains Pfam profile PF03141: Putative methyltransferase Length = 623 Score = 28.7 bits (61), Expect = 3.9 Identities = 18/53 (33%), Positives = 22/53 (41%) Frame = +1 Query: 7 GVEYSWRKDGMHFSVGQDTLTTIDAGSLVFSQTKASDEGEYQCFAKSDFGVAS 165 G + S+ G HF G D A L FS +DEG + GVAS Sbjct: 176 GEKISFPGGGTHFHYGADKYIASIANMLNFSNDVLNDEGRLRTVLDVGCGVAS 228 >At4g15490.1 68417.m02367 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase ;simalr to UDP-glucose:sinapate glucosyltransferase GI:9794913 from [Brassica napus] Length = 479 Score = 28.3 bits (60), Expect = 5.2 Identities = 9/18 (50%), Positives = 16/18 (88%) Frame = -3 Query: 122 PSSEALVWLNTREPASIV 69 P+S+ + WL++REP+S+V Sbjct: 266 PASDCMEWLDSREPSSVV 283 >At3g63260.2 68416.m07109 protein kinase, putative (MRK1) identical to ATMRK1 [Arabidopsis thaliana] gi|2351097|dbj|BAA22079 Length = 344 Score = 28.3 bits (60), Expect = 5.2 Identities = 15/42 (35%), Positives = 20/42 (47%) Frame = +1 Query: 145 SDFGVASTRATKLRRTYIETPAFEEKKVTVVEGKPFELRCPV 270 +DFGVA A + ET V+EGKP+ +C V Sbjct: 250 ADFGVARVEAQNPQDMTGETGTLGYMAPEVLEGKPYNRKCDV 291 >At3g63260.1 68416.m07108 protein kinase, putative (MRK1) identical to ATMRK1 [Arabidopsis thaliana] gi|2351097|dbj|BAA22079 Length = 391 Score = 28.3 bits (60), Expect = 5.2 Identities = 15/42 (35%), Positives = 20/42 (47%) Frame = +1 Query: 145 SDFGVASTRATKLRRTYIETPAFEEKKVTVVEGKPFELRCPV 270 +DFGVA A + ET V+EGKP+ +C V Sbjct: 250 ADFGVARVEAQNPQDMTGETGTLGYMAPEVLEGKPYNRKCDV 291 >At5g13520.1 68418.m01561 peptidase M1 family protein similar to SP|P09960 Leukotriene A-4 hydrolase (EC 3.3.2.6) (LTA-4 hydrolase) {Homo sapiens}; contains Pfam profile PF01433: Peptidase family M1 Length = 616 Score = 27.9 bits (59), Expect = 6.8 Identities = 14/33 (42%), Positives = 21/33 (63%) Frame = -3 Query: 191 VRRSLVALVLATPKSLLAKHWYSPSSEALVWLN 93 +R + V +VL+ SLL + SPS+ AL WL+ Sbjct: 81 IRGTEVVVVLSGQSSLLIVYSTSPSASALQWLS 113 >At5g04360.1 68418.m00428 pullulanase, putative / starch debranching enzyme, putative similar to pullulanase [Spinacia oleracea] GI:634093 (EC 3.2.1.41); contains Pfam profiles PF00128: Alpha amylase catalytic domain, PF02922: Isoamylase N-terminal domain Length = 965 Score = 27.9 bits (59), Expect = 6.8 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -1 Query: 562 PPRGHSSTEGSALHTWAPRRESLA*C 485 P H + EG +LH WAP ++++ C Sbjct: 207 PLGAHFTPEGVSLHLWAPTAQAVSVC 232 >At4g15500.1 68417.m02368 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 475 Score = 27.9 bits (59), Expect = 6.8 Identities = 9/18 (50%), Positives = 15/18 (83%) Frame = -3 Query: 122 PSSEALVWLNTREPASIV 69 P S+ + WL++REP+S+V Sbjct: 262 PDSDCIEWLDSREPSSVV 279 >At3g49830.1 68416.m05448 DNA helicase-related similar to DNA helicase GI:4521249 from [Mus musculus] Length = 473 Score = 27.9 bits (59), Expect = 6.8 Identities = 15/38 (39%), Positives = 22/38 (57%) Frame = +1 Query: 34 GMHFSVGQDTLTTIDAGSLVFSQTKASDEGEYQCFAKS 147 G+ S+GQ+T T+ AGS +FS + E Q F K+ Sbjct: 85 GIAKSLGQETPFTMIAGSEIFSLEMSKTEALTQAFRKA 122 >At5g41830.1 68418.m05093 F-box family protein-related contains a novel domain similar to F-box that is shared among other proteins in Arabidopsis; similar to proteins At3g54160, At1g47920 (syntaxin SYP81), At3g44180, At1g56610, At3g58890, At1g48390, At3g59270 [Arabidopsis thaliana] Length = 463 Score = 27.5 bits (58), Expect = 9.0 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = -3 Query: 107 LVWLNTREPASIVVSVS*PTLKCMPSFRHE 18 L+W + EP V+VS PTLK + R E Sbjct: 162 LIWEESSEPEPCYVTVSVPTLKILKFSRFE 191 >At1g43760.1 68414.m05034 hypothetical protein Length = 626 Score = 27.5 bits (58), Expect = 9.0 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = -1 Query: 334 QWNRPRHDVSSSLWSASGSPRALDSG 257 +WN R + + SGSPRAL SG Sbjct: 143 KWNISRSSAADHISKVSGSPRALVSG 168 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.315 0.133 0.404 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,417,953 Number of Sequences: 28952 Number of extensions: 378779 Number of successful extensions: 833 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 802 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 833 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1496852856 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (22.0 bits)
- SilkBase 1999-2023 -