BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0550 (800 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC926.07c |dlc2||dynein light chain Dlc2|Schizosaccharomyces p... 151 1e-37 SPCC16C4.01 |sif2|SPCC5E4.09|Sad1 interacting factor 2|Schizosac... 27 2.3 SPBC25D12.06 |||RNA helicase |Schizosaccharomyces pombe|chr 2|||... 26 7.2 SPAC9E9.12c |ybt1|abc1|ABC transporter Ybt1|Schizosaccharomyces ... 25 9.5 >SPAC926.07c |dlc2||dynein light chain Dlc2|Schizosaccharomyces pombe|chr 1|||Manual Length = 85 Score = 151 bits (366), Expect = 1e-37 Identities = 67/84 (79%), Positives = 76/84 (90%) Frame = +2 Query: 50 AVIKNADMSEEMQQDAVDCATQALEKFNIEKDIAAFIKKEFDKKYNPTWHCIVGRNFGSY 229 AVIK DMSE+MQQ+A+ A QA+EKF IEKDIAAFIK+EFDKK++PTWHCIVGRNFGS+ Sbjct: 2 AVIKAVDMSEKMQQEAIHAAVQAMEKFTIEKDIAAFIKREFDKKFSPTWHCIVGRNFGSF 61 Query: 230 VTHETRHFIYFYLGQVAILLFKSG 301 VTHE+RHFIYFYLG VA LLFKSG Sbjct: 62 VTHESRHFIYFYLGTVAFLLFKSG 85 >SPCC16C4.01 |sif2|SPCC5E4.09|Sad1 interacting factor 2|Schizosaccharomyces pombe|chr 3|||Manual Length = 446 Score = 27.5 bits (58), Expect = 2.3 Identities = 16/43 (37%), Positives = 24/43 (55%), Gaps = 1/43 (2%) Frame = -2 Query: 400 PQPEPRMRICKGYPSDNTASAA-NKKIEVMLNGLTALKEQYSH 275 PQ EP + Y N A N+++EV+ + L+ LKEQ +H Sbjct: 307 PQLEPIYTAARSYLEINQRVALLNQRVEVIGDLLSMLKEQITH 349 >SPBC25D12.06 |||RNA helicase |Schizosaccharomyces pombe|chr 2|||Manual Length = 565 Score = 25.8 bits (54), Expect = 7.2 Identities = 15/41 (36%), Positives = 24/41 (58%) Frame = -2 Query: 361 PSDNTASAANKKIEVMLNGLTALKEQYSHLSQVEVDEVASL 239 P+DN A+ IE +L+G+T KE+ H+ ++ ASL Sbjct: 160 PNDNLAAQYQFWIERLLHGITE-KEELQHIYKILTLTPASL 199 >SPAC9E9.12c |ybt1|abc1|ABC transporter Ybt1|Schizosaccharomyces pombe|chr 1|||Manual Length = 1427 Score = 25.4 bits (53), Expect = 9.5 Identities = 9/26 (34%), Positives = 16/26 (61%) Frame = +1 Query: 508 LHCLFNXKFTMLDINCVLPLHLIPGA 585 L C+ TML++ V+P+ ++P A Sbjct: 982 LLCVMAILITMLNVTLVMPIFMVPAA 1007 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,723,819 Number of Sequences: 5004 Number of extensions: 48641 Number of successful extensions: 109 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 108 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 109 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 388424860 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -