BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0547 (750 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_06_0439 + 33952765-33953238,33953368-33953844 29 3.9 06_03_0565 - 22308074-22309510,22309670-22309723 29 5.2 >03_06_0439 + 33952765-33953238,33953368-33953844 Length = 316 Score = 29.1 bits (62), Expect = 3.9 Identities = 11/37 (29%), Positives = 21/37 (56%) Frame = +2 Query: 116 KKNGLRRNATVVCINHGQRTGWHRLSDHRETKQEKSE 226 KK LR + V+C + ++ W ++ +E K+E S+ Sbjct: 153 KKGSLRLDDWVLCRLYNKKNEWEKMQQGKEVKEEASD 189 >06_03_0565 - 22308074-22309510,22309670-22309723 Length = 496 Score = 28.7 bits (61), Expect = 5.2 Identities = 11/29 (37%), Positives = 19/29 (65%) Frame = -2 Query: 464 IGNLVGVSQAVEYQSVQGWTWLYGITGLA 378 +G L+ V+ AV + +GW W +GI+ +A Sbjct: 106 VGALIAVTFAVWVEDNKGWQWGFGISTIA 134 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,356,845 Number of Sequences: 37544 Number of extensions: 389823 Number of successful extensions: 904 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 892 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 904 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1992480932 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -