BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0527 (750 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF592538-1|ABQ95984.1| 582|Tribolium castaneum beta-N-acetylglu... 26 0.37 U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse ... 23 2.6 AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax pr... 21 8.0 AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax pr... 21 8.0 AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax pr... 21 8.0 AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax pr... 21 8.0 AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax pr... 21 8.0 AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. 21 8.0 AF261823-1|AAG13010.1| 157|Tribolium castaneum cephalothorax pr... 21 8.0 AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduce... 21 8.0 >EF592538-1|ABQ95984.1| 582|Tribolium castaneum beta-N-acetylglucosaminidase NAG3 protein. Length = 582 Score = 25.8 bits (54), Expect = 0.37 Identities = 15/50 (30%), Positives = 22/50 (44%) Frame = +3 Query: 27 KSVGIISEGNETVXDIAARLNIPXXEVNPREAKAAVVHGTELRELNSDQL 176 KS+ + GN++ I +NI + N + K EL L SD L Sbjct: 121 KSLESLKPGNQSTPGIKLSINIILSDPNTNKLKLNTNESYELTVLKSDSL 170 >U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse transcriptase andRNase H protein. Length = 712 Score = 23.0 bits (47), Expect = 2.6 Identities = 10/19 (52%), Positives = 14/19 (73%) Frame = +3 Query: 132 VVHGTELRELNSDQLDDIL 188 VV GTE+RE + +DD+L Sbjct: 444 VVLGTEVREFVVNYIDDLL 462 >AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 21.4 bits (43), Expect = 8.0 Identities = 8/17 (47%), Positives = 8/17 (47%) Frame = +1 Query: 544 APGYSNHPXHRSGNGHG 594 AP Y HP GHG Sbjct: 49 APQYPQHPYAAPAPGHG 65 >AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 21.4 bits (43), Expect = 8.0 Identities = 8/17 (47%), Positives = 8/17 (47%) Frame = +1 Query: 544 APGYSNHPXHRSGNGHG 594 AP Y HP GHG Sbjct: 49 APQYPQHPYAAPAPGHG 65 >AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax protein. Length = 230 Score = 21.4 bits (43), Expect = 8.0 Identities = 8/17 (47%), Positives = 8/17 (47%) Frame = +1 Query: 544 APGYSNHPXHRSGNGHG 594 AP Y HP GHG Sbjct: 49 APQYPQHPYAAPAPGHG 65 >AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 21.4 bits (43), Expect = 8.0 Identities = 8/17 (47%), Positives = 8/17 (47%) Frame = +1 Query: 544 APGYSNHPXHRSGNGHG 594 AP Y HP GHG Sbjct: 49 APQYPQHPYAAPAPGHG 65 >AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax protein. Length = 297 Score = 21.4 bits (43), Expect = 8.0 Identities = 8/17 (47%), Positives = 8/17 (47%) Frame = +1 Query: 544 APGYSNHPXHRSGNGHG 594 AP Y HP GHG Sbjct: 49 APQYPQHPYAAPAPGHG 65 >AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. Length = 312 Score = 21.4 bits (43), Expect = 8.0 Identities = 8/17 (47%), Positives = 8/17 (47%) Frame = +1 Query: 544 APGYSNHPXHRSGNGHG 594 AP Y HP GHG Sbjct: 49 APQYPQHPYAAPAPGHG 65 >AF261823-1|AAG13010.1| 157|Tribolium castaneum cephalothorax protein. Length = 157 Score = 21.4 bits (43), Expect = 8.0 Identities = 8/17 (47%), Positives = 8/17 (47%) Frame = +1 Query: 544 APGYSNHPXHRSGNGHG 594 AP Y HP GHG Sbjct: 49 APQYPQHPYAAPAPGHG 65 >AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduced Scr protein. Length = 312 Score = 21.4 bits (43), Expect = 8.0 Identities = 8/17 (47%), Positives = 8/17 (47%) Frame = +1 Query: 544 APGYSNHPXHRSGNGHG 594 AP Y HP GHG Sbjct: 49 APQYPQHPYAAPAPGHG 65 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 118,540 Number of Sequences: 336 Number of extensions: 1903 Number of successful extensions: 14 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20027417 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -