BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0523 (750 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_28073| Best HMM Match : NMT (HMM E-Value=0) 227 1e-59 SB_7754| Best HMM Match : NMT_C (HMM E-Value=0) 174 7e-44 SB_7828| Best HMM Match : NMT (HMM E-Value=3.6e-11) 174 7e-44 SB_7983| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.046 SB_7328| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.43 SB_51412| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.76 SB_51793| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.76 SB_30657| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.00 SB_2673| Best HMM Match : UPF0154 (HMM E-Value=1.9) 31 1.00 SB_16082| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.00 SB_51518| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_47184| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_43357| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_37719| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_34389| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_31949| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_25885| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_22954| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_21699| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_16046| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_54957| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_54460| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_44605| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_36897| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_35458| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_29847| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_29479| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_21321| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_16515| Best HMM Match : Extensin_2 (HMM E-Value=0.12) 31 1.3 SB_15772| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_8012| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_5659| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_5116| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_1868| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_31617| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_50307| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_46054| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_29718| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_15930| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_4251| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_54841| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_49541| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_45414| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_25809| Best HMM Match : zf-C5HC2 (HMM E-Value=3.9) 29 3.0 SB_25125| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_22449| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_51859| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_50640| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_41160| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_40924| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_39599| Best HMM Match : Extensin_2 (HMM E-Value=0.09) 29 3.0 SB_37764| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_33393| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_31748| Best HMM Match : zf-HYPF (HMM E-Value=8.4) 29 3.0 SB_23633| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_21243| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_14480| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_11595| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_5408| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_26256| Best HMM Match : RNA_pol_Rpb1_R (HMM E-Value=8.9) 29 4.0 SB_1936| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.0 SB_31553| Best HMM Match : RCSD (HMM E-Value=2.7) 29 5.3 SB_15810| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.3 SB_49136| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.0 SB_26198| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.0 SB_55774| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_52357| Best HMM Match : fn2 (HMM E-Value=4.9) 28 9.3 SB_49019| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_20862| Best HMM Match : fn2 (HMM E-Value=3.4) 28 9.3 SB_17483| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_38281| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_21690| Best HMM Match : fn2 (HMM E-Value=3.4) 28 9.3 SB_9144| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_2775| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_2013| Best HMM Match : Lipase_GDSL (HMM E-Value=2.7) 28 9.3 >SB_28073| Best HMM Match : NMT (HMM E-Value=0) Length = 280 Score = 227 bits (554), Expect = 1e-59 Identities = 100/152 (65%), Positives = 123/152 (80%), Gaps = 1/152 (0%) Frame = +3 Query: 12 LKDLKMAMEVLNLQQ-KPAKTTEEALHKAYQFWSTQPVPKMDEKIIANEPIELPKSPEEI 188 LK+L+ EVL L + KPAKTTEEA K YQFW TQPVPK+D+++ + PIE KS EEI Sbjct: 93 LKNLQRYFEVLRLNEGKPAKTTEEAKKKTYQFWDTQPVPKIDDEVKESGPIEDNKSVEEI 152 Query: 189 RAEPYTLPDGFQWDTLNLNEPLVLKELYTLLNENYVEDDDCMFRFDYQTDFLKWALQPPG 368 R EPY+LP GF W+T+++ +P VLKELYTLLNENYVEDDD MFRFDY ++FL+WAL+PPG Sbjct: 153 RPEPYSLPQGFVWNTMDIGDPAVLKELYTLLNENYVEDDDNMFRFDYSSEFLQWALKPPG 212 Query: 369 WKMEWHCGVRVVKSGRLVGFISATPADLRIYN 464 WKM+WHCGVRV + +LVGFISA PA + +YN Sbjct: 213 WKMDWHCGVRVASNNKLVGFISAIPAHINVYN 244 >SB_7754| Best HMM Match : NMT_C (HMM E-Value=0) Length = 247 Score = 174 bits (423), Expect = 7e-44 Identities = 78/90 (86%), Positives = 86/90 (95%) Frame = +3 Query: 477 VVEINFLCVHKKLRSKRVAPVLIREITRRVNLTGIFQGVYTAGIVLPKPIATCRYWHRSL 656 +VEINFLCVHKKLRSKRVAPVLIREITRRVN GIFQ VYTAG+VLPKP+A CRYWHRSL Sbjct: 2 MVEINFLCVHKKLRSKRVAPVLIREITRRVNKEGIFQAVYTAGVVLPKPVACCRYWHRSL 61 Query: 657 NPKKLIDIKFSHLSRNMTMQRTLKLFKLPD 746 NPKKLID+KFSHLSRNMTMQRT+KL++LP+ Sbjct: 62 NPKKLIDVKFSHLSRNMTMQRTVKLYRLPE 91 >SB_7828| Best HMM Match : NMT (HMM E-Value=3.6e-11) Length = 104 Score = 174 bits (423), Expect = 7e-44 Identities = 78/90 (86%), Positives = 86/90 (95%) Frame = +3 Query: 477 VVEINFLCVHKKLRSKRVAPVLIREITRRVNLTGIFQGVYTAGIVLPKPIATCRYWHRSL 656 +VEINFLCVHKKLRSKRVAPVLIREITRRVN GIFQ VYTAG+VLPKP+A CRYWHRSL Sbjct: 2 MVEINFLCVHKKLRSKRVAPVLIREITRRVNKEGIFQAVYTAGVVLPKPVACCRYWHRSL 61 Query: 657 NPKKLIDIKFSHLSRNMTMQRTLKLFKLPD 746 NPKKLID+KFSHLSRNMTMQRT+KL++LP+ Sbjct: 62 NPKKLIDVKFSHLSRNMTMQRTVKLYRLPE 91 >SB_7983| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 836 Score = 35.5 bits (78), Expect = 0.046 Identities = 17/54 (31%), Positives = 28/54 (51%) Frame = -1 Query: 402 PHEHHNAIPFSNQVVVEPISKNQFGNQNETYNHHLPHNFH*VKCTVLSILKVRS 241 PH HH+AI + ++ P+S + +Q +HH PH+ H T+ I+ S Sbjct: 490 PHHHHSAITTIHIIITAPLSPSTSSSQR---HHHHPHHHHSAIITIHIIITAPS 540 Score = 33.9 bits (74), Expect = 0.14 Identities = 16/56 (28%), Positives = 30/56 (53%) Frame = -1 Query: 402 PHEHHNAIPFSNQVVVEPISKNQFGNQNETYNHHLPHNFH*VKCTVLSILKVRSNS 235 PH +H+AI N ++ P + +Q +HH P+++H T+ I+ +R+ S Sbjct: 654 PHHYHSAITTINIIITAPSPPSTSSSQR---HHHHPYHYHSAITTIHIIILIRAPS 706 Score = 33.5 bits (73), Expect = 0.19 Identities = 16/54 (29%), Positives = 27/54 (50%) Frame = -1 Query: 402 PHEHHNAIPFSNQVVVEPISKNQFGNQNETYNHHLPHNFH*VKCTVLSILKVRS 241 PH HH+AI + ++ P + +Q +HH PH++H T+ I+ S Sbjct: 622 PHHHHSAITTIHIIITAPSPPSTSSSQR---HHHHPHHYHSAITTINIIITAPS 672 Score = 33.1 bits (72), Expect = 0.25 Identities = 16/54 (29%), Positives = 27/54 (50%) Frame = -1 Query: 402 PHEHHNAIPFSNQVVVEPISKNQFGNQNETYNHHLPHNFH*VKCTVLSILKVRS 241 PH HH+AI + ++ P + +Q +HH PH+ H T+ I+ +S Sbjct: 230 PHHHHSAITTIHIIITAPSPPSTSSSQR---HHHHPHHHHSAIITIHIIITAQS 280 Score = 32.7 bits (71), Expect = 0.33 Identities = 16/50 (32%), Positives = 26/50 (52%) Frame = -1 Query: 402 PHEHHNAIPFSNQVVVEPISKNQFGNQNETYNHHLPHNFH*VKCTVLSIL 253 PH HH+AI + ++ P S + +Q +HH PH+ H T+ I+ Sbjct: 458 PHHHHSAIITIHIIITAPSSPSTSSSQR---HHHHPHHHHSAITTIHIII 504 Score = 31.9 bits (69), Expect = 0.57 Identities = 16/54 (29%), Positives = 26/54 (48%) Frame = -1 Query: 402 PHEHHNAIPFSNQVVVEPISKNQFGNQNETYNHHLPHNFH*VKCTVLSILKVRS 241 PH HH+AI + ++ P + +Q +HH PH+ H T+ I+ S Sbjct: 68 PHHHHSAITTIHIIITAPSPPSTSSSQR---HHHHPHHHHSAIITIHIIITAPS 118 Score = 31.5 bits (68), Expect = 0.76 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = -1 Query: 402 PHEHHNAIPFSNQVVVEPISKNQFGNQNETYNHHLPHN 289 PH HH+AI + ++ P S + +Q NHH PH+ Sbjct: 164 PHHHHSAITTIHIIITAPSSPSISSSQR---NHHHPHH 198 Score = 31.5 bits (68), Expect = 0.76 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = -1 Query: 402 PHEHHNAIPFSNQVVVEPISKNQFGNQNETYNHHLPHN 289 PH HH+AI + ++ P S + +Q NHH PH+ Sbjct: 326 PHHHHSAITTIHIIITAPSSPSISSSQR---NHHHPHH 360 Score = 31.1 bits (67), Expect = 1.00 Identities = 16/55 (29%), Positives = 27/55 (49%) Frame = -1 Query: 402 PHEHHNAIPFSNQVVVEPISKNQFGNQNETYNHHLPHNFH*VKCTVLSILKVRSN 238 PH HH+AI + ++ P + +Q +HH PH+ H T+ I+ S+ Sbjct: 294 PHHHHSAIITIHIIITVPSPPSTSSSQR---HHHHPHHHHSAITTIHIIITAPSS 345 Score = 30.7 bits (66), Expect = 1.3 Identities = 17/54 (31%), Positives = 26/54 (48%) Frame = -1 Query: 402 PHEHHNAIPFSNQVVVEPISKNQFGNQNETYNHHLPHNFH*VKCTVLSILKVRS 241 PH HH+AI + + P + +Q Y+HH PH+ H T+ I+ S Sbjct: 36 PHHHHSAITTIHIITTVPSPTSTSSSQR--YHHH-PHHHHSAITTIHIIITAPS 86 Score = 30.3 bits (65), Expect = 1.7 Identities = 15/50 (30%), Positives = 26/50 (52%) Frame = -1 Query: 402 PHEHHNAIPFSNQVVVEPISKNQFGNQNETYNHHLPHNFH*VKCTVLSIL 253 PH HH+AI + ++ P S + +Q ++HH H+ H T + I+ Sbjct: 392 PHHHHSAITTIHIIITAPSSPSISSSQR--HHHHPHHHSHHSAITNIHII 439 Score = 29.1 bits (62), Expect = 4.0 Identities = 16/53 (30%), Positives = 26/53 (49%) Frame = -1 Query: 399 HEHHNAIPFSNQVVVEPISKNQFGNQNETYNHHLPHNFH*VKCTVLSILKVRS 241 H HH+AI + ++ P + +Q Y+HH PH+ H T+ I+ S Sbjct: 199 HSHHSAITNIHIIITAPSPPSTSSSQR--YHHH-PHHHHSAITTIHIIITAPS 248 Score = 29.1 bits (62), Expect = 4.0 Identities = 15/54 (27%), Positives = 26/54 (48%) Frame = -1 Query: 399 HEHHNAIPFSNQVVVEPISKNQFGNQNETYNHHLPHNFH*VKCTVLSILKVRSN 238 H HH+AI + ++ P + +Q +HH PH+ H T+ I+ S+ Sbjct: 427 HSHHSAITNIHIIITAPSPPSTSSSQR---HHHHPHHHHSAIITIHIIITAPSS 477 Score = 28.7 bits (61), Expect = 5.3 Identities = 15/54 (27%), Positives = 26/54 (48%) Frame = -1 Query: 399 HEHHNAIPFSNQVVVEPISKNQFGNQNETYNHHLPHNFH*VKCTVLSILKVRSN 238 H HH+AI + ++ P + +Q +HH PH+ H T+ I+ S+ Sbjct: 361 HSHHSAITNIHIIITVPSPPSTSSSQR---HHHHPHHHHSAITTIHIIITAPSS 411 Score = 27.9 bits (59), Expect = 9.3 Identities = 15/50 (30%), Positives = 24/50 (48%) Frame = -1 Query: 402 PHEHHNAIPFSNQVVVEPISKNQFGNQNETYNHHLPHNFH*VKCTVLSIL 253 PH H+AI + ++ P + Q Y+HH PH+ H T+ I+ Sbjct: 754 PHHQHSAIITIHIIITAPSPPSTSSTQR--YHHH-PHHHHSAIITIYIIV 800 >SB_7328| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 32.3 bits (70), Expect = 0.43 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = +3 Query: 318 RFDYQTDFLKWALQPPGWKM 377 RFDY+TD L AL P WKM Sbjct: 3 RFDYETDALPTALTTPSWKM 22 >SB_51412| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 31.5 bits (68), Expect = 0.76 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = +3 Query: 318 RFDYQTDFLKWALQPPGWKM 377 RFDYQTD L AL P W+M Sbjct: 3 RFDYQTDALPIALTTPSWEM 22 >SB_51793| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 31.5 bits (68), Expect = 0.76 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = +3 Query: 318 RFDYQTDFLKWALQPPGWKM 377 RFDYQTD L AL P W+M Sbjct: 3 RFDYQTDALPIALTTPSWEM 22 >SB_30657| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 31.1 bits (67), Expect = 1.00 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = +3 Query: 318 RFDYQTDFLKWALQPPGWKM 377 RFDY+TD L AL P WKM Sbjct: 61 RFDYETDALPIALTTPTWKM 80 Score = 29.5 bits (63), Expect = 3.0 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = +3 Query: 318 RFDYQTDFLKWALQPPGWKM 377 RFDY+TD L AL P W+M Sbjct: 3 RFDYETDALAIALTTPTWEM 22 >SB_2673| Best HMM Match : UPF0154 (HMM E-Value=1.9) Length = 322 Score = 31.1 bits (67), Expect = 1.00 Identities = 17/54 (31%), Positives = 28/54 (51%), Gaps = 2/54 (3%) Frame = +3 Query: 189 RAEPYTLPDGFQ-WDTLNLNEPLVLKELYTLLNENY-VEDDDCMFRFDYQTDFL 344 + P + D Q W L+ LK+LY +Y + +++C F F Y+T+FL Sbjct: 130 KGRPVVVTDAAQNWSALDTFNFTFLKKLYDSSKNSYKITEEECQF-FPYKTEFL 182 >SB_16082| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 31.1 bits (67), Expect = 1.00 Identities = 15/30 (50%), Positives = 18/30 (60%) Frame = +3 Query: 288 NYVEDDDCMFRFDYQTDFLKWALQPPGWKM 377 +Y D + RFDYQTD L AL P W+M Sbjct: 34 DYRTHDLQISRFDYQTDALPIALTTPTWEM 63 >SB_51518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 30.7 bits (66), Expect = 1.3 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = +3 Query: 318 RFDYQTDFLKWALQPPGWKM 377 RFDYQTD L AL P W+M Sbjct: 25 RFDYQTDALPIALTTPTWEM 44 >SB_47184| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 30.7 bits (66), Expect = 1.3 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = +3 Query: 318 RFDYQTDFLKWALQPPGWKM 377 RFDYQTD L AL P W+M Sbjct: 18 RFDYQTDALPIALTTPTWEM 37 >SB_43357| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 30.7 bits (66), Expect = 1.3 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = +3 Query: 318 RFDYQTDFLKWALQPPGWKM 377 RF+Y+TD L AL P WKM Sbjct: 24 RFEYETDALPTALTTPSWKM 43 >SB_37719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 30.7 bits (66), Expect = 1.3 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = +3 Query: 318 RFDYQTDFLKWALQPPGWKM 377 RFDYQTD L AL P W+M Sbjct: 3 RFDYQTDALPIALTTPTWEM 22 >SB_34389| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 30.7 bits (66), Expect = 1.3 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = +3 Query: 318 RFDYQTDFLKWALQPPGWKM 377 RFDYQTD L AL P W+M Sbjct: 3 RFDYQTDALPIALTTPTWEM 22 >SB_31949| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 30.7 bits (66), Expect = 1.3 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = +3 Query: 318 RFDYQTDFLKWALQPPGWKM 377 RFDYQTD L AL P W+M Sbjct: 44 RFDYQTDALPIALTTPTWEM 63 >SB_25885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 30.7 bits (66), Expect = 1.3 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = +3 Query: 318 RFDYQTDFLKWALQPPGWKM 377 RFDYQTD L AL P W+M Sbjct: 44 RFDYQTDALPIALTTPTWEM 63 >SB_22954| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 30.7 bits (66), Expect = 1.3 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = +3 Query: 318 RFDYQTDFLKWALQPPGWKM 377 RFDYQTD L AL P W+M Sbjct: 24 RFDYQTDALPIALTTPTWEM 43 >SB_21699| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 30.7 bits (66), Expect = 1.3 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = +3 Query: 318 RFDYQTDFLKWALQPPGWKM 377 RFDYQTD L AL P W+M Sbjct: 3 RFDYQTDALPIALTTPTWEM 22 >SB_16046| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 30.7 bits (66), Expect = 1.3 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = +3 Query: 318 RFDYQTDFLKWALQPPGWKM 377 RFDYQTD L AL P W+M Sbjct: 3 RFDYQTDALPIALTTPTWEM 22 >SB_54957| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 30.7 bits (66), Expect = 1.3 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = +3 Query: 318 RFDYQTDFLKWALQPPGWKM 377 RFDYQTD L AL P W+M Sbjct: 3 RFDYQTDALPIALTTPTWEM 22 >SB_54460| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 30.7 bits (66), Expect = 1.3 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = +3 Query: 318 RFDYQTDFLKWALQPPGWKM 377 RFDYQTD L AL P W+M Sbjct: 3 RFDYQTDALPIALTTPTWEM 22 >SB_44605| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 115 Score = 30.7 bits (66), Expect = 1.3 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = +3 Query: 318 RFDYQTDFLKWALQPPGWKM 377 RFDYQTD L AL P W+M Sbjct: 41 RFDYQTDALPIALTTPTWEM 60 >SB_36897| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 30.7 bits (66), Expect = 1.3 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = +3 Query: 318 RFDYQTDFLKWALQPPGWKM 377 RFDYQTD L AL P W+M Sbjct: 3 RFDYQTDALPIALTTPTWEM 22 >SB_35458| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 30.7 bits (66), Expect = 1.3 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = +3 Query: 318 RFDYQTDFLKWALQPPGWKM 377 RFDYQTD L AL P W+M Sbjct: 18 RFDYQTDALPIALTTPTWEM 37 >SB_29847| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 30.7 bits (66), Expect = 1.3 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = +3 Query: 318 RFDYQTDFLKWALQPPGWKM 377 RFDYQTD L AL P W+M Sbjct: 45 RFDYQTDALPIALTTPTWEM 64 >SB_29479| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 30.7 bits (66), Expect = 1.3 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = +3 Query: 318 RFDYQTDFLKWALQPPGWKM 377 RFDYQTD L AL P W+M Sbjct: 44 RFDYQTDALPIALTTPTWEM 63 >SB_21321| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 30.7 bits (66), Expect = 1.3 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = +3 Query: 318 RFDYQTDFLKWALQPPGWKM 377 RFDYQTD L AL P W+M Sbjct: 44 RFDYQTDALPIALTTPTWEM 63 >SB_16515| Best HMM Match : Extensin_2 (HMM E-Value=0.12) Length = 917 Score = 30.7 bits (66), Expect = 1.3 Identities = 16/59 (27%), Positives = 29/59 (49%) Frame = +3 Query: 48 LQQKPAKTTEEALHKAYQFWSTQPVPKMDEKIIANEPIELPKSPEEIRAEPYTLPDGFQ 224 L+Q P +EA+ + + QP + + ++ P+E P+ PE R + + DG Q Sbjct: 609 LEQPPEPLPQEAVEQPAR--KAQPQSQQQQVVVPEPPVEPPQVPEPPRVDRISPFDGMQ 665 >SB_15772| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 30.7 bits (66), Expect = 1.3 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = +3 Query: 318 RFDYQTDFLKWALQPPGWKM 377 RFDYQTD L AL P W+M Sbjct: 25 RFDYQTDALPIALTTPTWEM 44 >SB_8012| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 30.7 bits (66), Expect = 1.3 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = +3 Query: 318 RFDYQTDFLKWALQPPGWKM 377 RFDYQTD L AL P W+M Sbjct: 3 RFDYQTDALPIALTTPTWEM 22 >SB_5659| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 30.7 bits (66), Expect = 1.3 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = +3 Query: 318 RFDYQTDFLKWALQPPGWKM 377 RF+Y+TD L AL P WKM Sbjct: 3 RFEYETDALPTALTTPSWKM 22 >SB_5116| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 30.7 bits (66), Expect = 1.3 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = +3 Query: 318 RFDYQTDFLKWALQPPGWKM 377 RFDYQTD L AL P W+M Sbjct: 3 RFDYQTDALPIALTTPTWEM 22 >SB_1868| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 30.7 bits (66), Expect = 1.3 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = +3 Query: 318 RFDYQTDFLKWALQPPGWKM 377 RFDYQTD L AL P W+M Sbjct: 18 RFDYQTDALPIALTTPTWEM 37 >SB_31617| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 30.3 bits (65), Expect = 1.7 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = +3 Query: 318 RFDYQTDFLKWALQPPGWKM 377 RFDY+TD L AL P W+M Sbjct: 3 RFDYETDALPIALTTPSWEM 22 >SB_50307| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 115 Score = 30.3 bits (65), Expect = 1.7 Identities = 12/20 (60%), Positives = 15/20 (75%) Frame = +3 Query: 318 RFDYQTDFLKWALQPPGWKM 377 RFDY+TD L AL+ P W+M Sbjct: 41 RFDYETDALPIALRTPTWEM 60 >SB_46054| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 30.3 bits (65), Expect = 1.7 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = +3 Query: 318 RFDYQTDFLKWALQPPGWKM 377 RFDY+TD L AL P W+M Sbjct: 3 RFDYETDALPIALTTPSWEM 22 >SB_29718| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 30.3 bits (65), Expect = 1.7 Identities = 12/20 (60%), Positives = 15/20 (75%) Frame = +3 Query: 318 RFDYQTDFLKWALQPPGWKM 377 RFDY+TD L AL+ P W+M Sbjct: 3 RFDYETDALPIALRTPTWEM 22 >SB_15930| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 30.3 bits (65), Expect = 1.7 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = +3 Query: 318 RFDYQTDFLKWALQPPGWKM 377 RFDY+TD L AL P W+M Sbjct: 3 RFDYETDALPIALTTPSWEM 22 >SB_4251| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 30.3 bits (65), Expect = 1.7 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = +3 Query: 318 RFDYQTDFLKWALQPPGWKM 377 RFDY+TD L AL P W+M Sbjct: 3 RFDYETDALPIALTTPSWEM 22 >SB_54841| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 29.5 bits (63), Expect = 3.0 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = +3 Query: 318 RFDYQTDFLKWALQPPGWKM 377 RFDY+TD L AL P W+M Sbjct: 3 RFDYETDALPIALTTPTWEM 22 >SB_49541| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 29.5 bits (63), Expect = 3.0 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = +3 Query: 318 RFDYQTDFLKWALQPPGWKM 377 RFDY+TD L AL P W+M Sbjct: 18 RFDYETDALPIALTTPTWEM 37 >SB_45414| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 87 Score = 29.5 bits (63), Expect = 3.0 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = +3 Query: 318 RFDYQTDFLKWALQPPGWKM 377 RFDY+TD L AL P W+M Sbjct: 13 RFDYETDALPIALTTPTWEM 32 >SB_25809| Best HMM Match : zf-C5HC2 (HMM E-Value=3.9) Length = 149 Score = 29.5 bits (63), Expect = 3.0 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = +3 Query: 318 RFDYQTDFLKWALQPPGWKM 377 RFDY+TD L AL P W+M Sbjct: 44 RFDYETDALPIALTTPTWEM 63 >SB_25125| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 29.5 bits (63), Expect = 3.0 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = +3 Query: 318 RFDYQTDFLKWALQPPGWKM 377 RFDY+TD L AL P W+M Sbjct: 17 RFDYETDALPIALTTPTWEM 36 >SB_22449| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 29.5 bits (63), Expect = 3.0 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = +3 Query: 318 RFDYQTDFLKWALQPPGWKM 377 RFDY+TD L AL P W+M Sbjct: 3 RFDYETDALPIALTTPTWEM 22 >SB_51859| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 29.5 bits (63), Expect = 3.0 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = +3 Query: 318 RFDYQTDFLKWALQPPGWKM 377 RFDY+TD L AL P W+M Sbjct: 114 RFDYETDALPIALTTPTWEM 133 >SB_50640| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 29.5 bits (63), Expect = 3.0 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = +3 Query: 318 RFDYQTDFLKWALQPPGWKM 377 RFDY+TD L AL P W+M Sbjct: 40 RFDYETDALPIALTTPTWEM 59 >SB_41160| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 29.5 bits (63), Expect = 3.0 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = +3 Query: 318 RFDYQTDFLKWALQPPGWKM 377 RFDY+TD L AL P W+M Sbjct: 3 RFDYETDALPIALTTPTWEM 22 >SB_40924| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 29.5 bits (63), Expect = 3.0 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = +3 Query: 318 RFDYQTDFLKWALQPPGWKM 377 RFDY+TD L AL P W+M Sbjct: 17 RFDYETDALPIALTTPTWEM 36 >SB_39599| Best HMM Match : Extensin_2 (HMM E-Value=0.09) Length = 564 Score = 29.5 bits (63), Expect = 3.0 Identities = 11/29 (37%), Positives = 19/29 (65%) Frame = -3 Query: 457 ILKSAGVAEMKPTSRPDFTTRTPQCHSIF 371 IL+ A ++ + P + TT+TP+CH +F Sbjct: 358 ILRVANISRITPYALIITTTKTPRCHKVF 386 >SB_37764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 29.5 bits (63), Expect = 3.0 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = +3 Query: 318 RFDYQTDFLKWALQPPGWKM 377 RFDY+TD L AL P W+M Sbjct: 3 RFDYETDALPIALTTPTWEM 22 >SB_33393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 29.5 bits (63), Expect = 3.0 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = +3 Query: 318 RFDYQTDFLKWALQPPGWKM 377 RFDY+TD L AL P W+M Sbjct: 3 RFDYETDALPIALTTPTWEM 22 >SB_31748| Best HMM Match : zf-HYPF (HMM E-Value=8.4) Length = 98 Score = 29.5 bits (63), Expect = 3.0 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = +3 Query: 318 RFDYQTDFLKWALQPPGWKM 377 RFDY+TD L AL P W+M Sbjct: 24 RFDYETDALPTALTRPTWEM 43 >SB_23633| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 29.5 bits (63), Expect = 3.0 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = +3 Query: 318 RFDYQTDFLKWALQPPGWKM 377 RFDY+TD L AL P W+M Sbjct: 61 RFDYETDALPIALTTPTWEM 80 >SB_21243| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 176 Score = 29.5 bits (63), Expect = 3.0 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = +3 Query: 318 RFDYQTDFLKWALQPPGWKM 377 RFDY+TD L AL P W+M Sbjct: 102 RFDYETDALPIALTTPTWEM 121 >SB_14480| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 29.5 bits (63), Expect = 3.0 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = +3 Query: 318 RFDYQTDFLKWALQPPGWKM 377 RFDY+TD L AL P W+M Sbjct: 3 RFDYETDALPIALTTPTWEM 22 >SB_11595| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 29.5 bits (63), Expect = 3.0 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = +3 Query: 318 RFDYQTDFLKWALQPPGWKM 377 RFDY+TD L AL P W+M Sbjct: 3 RFDYETDALAIALTTPTWEM 22 >SB_5408| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 29.5 bits (63), Expect = 3.0 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = +3 Query: 318 RFDYQTDFLKWALQPPGWKM 377 RFDY+TD L AL P W+M Sbjct: 119 RFDYETDALPIALTTPTWQM 138 >SB_26256| Best HMM Match : RNA_pol_Rpb1_R (HMM E-Value=8.9) Length = 313 Score = 29.1 bits (62), Expect = 4.0 Identities = 15/43 (34%), Positives = 20/43 (46%) Frame = +3 Query: 51 QQKPAKTTEEALHKAYQFWSTQPVPKMDEKIIANEPIELPKSP 179 ++ P KTTE A+ +TQP K+D I P P P Sbjct: 14 EELPVKTTEPAVLTPALTSATQPSVKLDRLSIPGNPFFTPSGP 56 >SB_1936| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 29.1 bits (62), Expect = 4.0 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = +3 Query: 318 RFDYQTDFLKWALQPPGWKM 377 RFDYQTD L L P W+M Sbjct: 3 RFDYQTDALPIGLTTPTWEM 22 >SB_31553| Best HMM Match : RCSD (HMM E-Value=2.7) Length = 139 Score = 28.7 bits (61), Expect = 5.3 Identities = 13/45 (28%), Positives = 24/45 (53%) Frame = +3 Query: 120 VPKMDEKIIANEPIELPKSPEEIRAEPYTLPDGFQWDTLNLNEPL 254 VP +D N ++PKSPE++++ +P + + N + PL Sbjct: 43 VPPIDTGDNENGDYDVPKSPEDVQSSTEDVPSSSKQELPNYDMPL 87 >SB_15810| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 312 Score = 28.7 bits (61), Expect = 5.3 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = +3 Query: 123 PKMDEKIIANEPIELPKSPEEIRAEPYTLPD 215 PK +EK+ EP+E+ +E + EPY PD Sbjct: 284 PKSEEKL---EPMEVDDKKKESKLEPYWFPD 311 >SB_49136| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1459 Score = 28.3 bits (60), Expect = 7.0 Identities = 18/69 (26%), Positives = 30/69 (43%), Gaps = 1/69 (1%) Frame = +3 Query: 162 ELPKSP-EEIRAEPYTLPDGFQWDTLNLNEPLVLKELYTLLNENYVEDDDCMFRFDYQTD 338 EL KS E +R EP +P Q L EP +KEL + + + F ++ Sbjct: 933 ELKKSVLESLRQEPAPIPPEVQHGWWRLTEPSNIKELVKACHSRGIREKMLQKNFQKYSE 992 Query: 339 FLKWALQPP 365 ++ + + P Sbjct: 993 YISSSCKKP 1001 >SB_26198| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 28.3 bits (60), Expect = 7.0 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = +3 Query: 321 FDYQTDFLKWALQPPGWKM 377 FDY+TD L AL P W+M Sbjct: 4 FDYETDALSTALTTPTWEM 22 >SB_55774| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = +3 Query: 321 FDYQTDFLKWALQPPGWKM 377 FDY+TD L AL P W+M Sbjct: 19 FDYETDALPTALTTPTWEM 37 >SB_52357| Best HMM Match : fn2 (HMM E-Value=4.9) Length = 100 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = +3 Query: 321 FDYQTDFLKWALQPPGWKM 377 FDY+TD L AL P W+M Sbjct: 27 FDYETDALPTALTTPTWEM 45 >SB_49019| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = +3 Query: 321 FDYQTDFLKWALQPPGWKM 377 FDY+TD L AL P W+M Sbjct: 4 FDYETDALPTALTTPTWEM 22 >SB_20862| Best HMM Match : fn2 (HMM E-Value=3.4) Length = 100 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = +3 Query: 321 FDYQTDFLKWALQPPGWKM 377 FDY+TD L AL P W+M Sbjct: 27 FDYETDALPTALTTPTWEM 45 >SB_17483| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = +3 Query: 321 FDYQTDFLKWALQPPGWKM 377 FDY+TD L AL P W+M Sbjct: 4 FDYETDALPTALTTPTWEM 22 >SB_38281| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +3 Query: 318 RFDYQTDFLKWALQPPGWKM 377 RFDY+T+ L AL P W+M Sbjct: 3 RFDYETEALPIALTTPTWEM 22 >SB_21690| Best HMM Match : fn2 (HMM E-Value=3.4) Length = 100 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = +3 Query: 321 FDYQTDFLKWALQPPGWKM 377 FDY+TD L AL P W+M Sbjct: 27 FDYETDALPTALTTPTWEM 45 >SB_9144| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 100 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = +3 Query: 321 FDYQTDFLKWALQPPGWKM 377 FDY+TD L AL P W+M Sbjct: 27 FDYETDALPTALTTPTWEM 45 >SB_2775| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 27.9 bits (59), Expect = 9.3 Identities = 15/50 (30%), Positives = 30/50 (60%), Gaps = 2/50 (4%) Frame = -1 Query: 372 SNQVVVEPISKNQFGNQNETY--NHHLPHNFH*VKCTVLSILKVRSNSKY 229 S+QV E ++K+++ N ++T+ N+H H+F+ +C + K +S Y Sbjct: 26 SSQVWCELLAKDKY-NASDTFDPNNHTSHHFNIPECKTRQLSKTTRSSFY 74 >SB_2013| Best HMM Match : Lipase_GDSL (HMM E-Value=2.7) Length = 518 Score = 27.9 bits (59), Expect = 9.3 Identities = 17/65 (26%), Positives = 34/65 (52%) Frame = +3 Query: 111 TQPVPKMDEKIIANEPIELPKSPEEIRAEPYTLPDGFQWDTLNLNEPLVLKELYTLLNEN 290 T VP++ E ++ + P+E+ +P+ + F TLNL +PL ++ +T + + Sbjct: 330 TTAVPRLPEPLLLDNPLEIITNPKCSTSVTPNYKQDFYHRTLNL-KPLSIQG-FTFIVKR 387 Query: 291 YVEDD 305 Y+ D Sbjct: 388 YLNFD 392 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,201,143 Number of Sequences: 59808 Number of extensions: 497650 Number of successful extensions: 1448 Number of sequences better than 10.0: 75 Number of HSP's better than 10.0 without gapping: 1285 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1437 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2034222073 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -