BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0523 (750 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY347946-1|AAR28374.1| 640|Anopheles gambiae putative NPY GPCR ... 25 3.3 CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transpos... 23 7.6 AJ302655-1|CAC35520.1| 332|Anopheles gambiae gSG5 protein protein. 23 7.6 >AY347946-1|AAR28374.1| 640|Anopheles gambiae putative NPY GPCR protein. Length = 640 Score = 24.6 bits (51), Expect = 3.3 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = -1 Query: 345 SKNQFGNQNETYNHHLPHNFH*VKC 271 SK +F QN HLPH H KC Sbjct: 351 SKRKFSQQNCCEQQHLPH-VHSEKC 374 >CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transposon polyprotein protein. Length = 1726 Score = 23.4 bits (48), Expect = 7.6 Identities = 13/36 (36%), Positives = 21/36 (58%) Frame = +3 Query: 258 LKELYTLLNENYVEDDDCMFRFDYQTDFLKWALQPP 365 L+ELY LLN + +D+ + + + D +KW PP Sbjct: 1505 LRELYKLLNSDTHQDE--VVGWCAERD-MKWKFTPP 1537 >AJ302655-1|CAC35520.1| 332|Anopheles gambiae gSG5 protein protein. Length = 332 Score = 23.4 bits (48), Expect = 7.6 Identities = 13/44 (29%), Positives = 25/44 (56%) Frame = +3 Query: 468 VQTVVEINFLCVHKKLRSKRVAPVLIREITRRVNLTGIFQGVYT 599 V+ V+ + L +H+KL ++ P ++ + R NL +FQ + T Sbjct: 67 VEEVLPTDPLELHEKLENETDIPRMVVQNISRPNLGELFQKLTT 110 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 813,972 Number of Sequences: 2352 Number of extensions: 17678 Number of successful extensions: 34 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 33 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 34 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 77339358 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -