BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0522 (750 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_03_0481 + 16433648-16433746,16435136-16435394,16435883-164362... 31 1.3 04_03_0471 - 16292916-16293209,16294558-16294803,16297557-162976... 28 9.1 >04_03_0481 + 16433648-16433746,16435136-16435394,16435883-16436261, 16436498-16436716,16436814-16436949,16437502-16437717, 16437773-16437835 Length = 456 Score = 30.7 bits (66), Expect = 1.3 Identities = 11/37 (29%), Positives = 22/37 (59%) Frame = +2 Query: 98 LAAVDEWWVAFEENLILTFINEREQKRYCLVHLIW*E 208 L A+ EWW E++ L+++ +R + Y H+++ E Sbjct: 241 LKAISEWWRDLNEHVELSYLRDRVVESYTCSHMLFYE 277 >04_03_0471 - 16292916-16293209,16294558-16294803,16297557-16297692, 16297765-16297983,16298194-16298572,16298967-16299225, 16300044-16300114,16300604-16300625 Length = 541 Score = 27.9 bits (59), Expect = 9.1 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = +2 Query: 98 LAAVDEWWVAFEENLILTFINEREQKRYCLVH 193 L A+ EWW + + LT+I++R + Y H Sbjct: 239 LKAISEWWKDLYKYIGLTYISDRAVESYIWSH 270 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,851,769 Number of Sequences: 37544 Number of extensions: 270214 Number of successful extensions: 407 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 401 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 407 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1992480932 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -