BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0517 (750 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g62290.1 68414.m07027 aspartyl protease family protein contai... 173 1e-43 At1g11910.1 68414.m01374 aspartyl protease family protein contai... 173 1e-43 At4g04460.1 68417.m00648 aspartyl protease family protein contai... 171 3e-43 At4g22050.1 68417.m03189 aspartyl protease family protein contai... 110 1e-24 At1g69100.1 68414.m07907 aspartyl protease family protein contai... 97 8e-21 At3g42550.1 68416.m04414 aspartyl protease family protein weak s... 48 7e-06 At3g51350.1 68416.m05622 aspartyl protease family protein contai... 43 2e-04 At1g31450.1 68414.m03851 aspartyl protease family protein contai... 43 2e-04 At5g45120.1 68418.m05539 aspartyl protease family protein contai... 42 3e-04 At1g08210.1 68414.m00907 aspartyl protease family protein contai... 42 3e-04 At1g05840.1 68414.m00611 aspartyl protease family protein contai... 41 8e-04 At2g35615.1 68415.m04367 aspartyl protease family protein contai... 41 0.001 At5g10080.1 68418.m01168 aspartyl protease family protein contai... 40 0.001 At3g12700.1 68416.m01587 aspartyl protease family protein contai... 40 0.001 At2g36670.2 68415.m04498 aspartyl protease family protein contai... 40 0.002 At2g28010.1 68415.m03394 aspartyl protease family protein contai... 40 0.002 At5g36260.1 68418.m04374 aspartyl protease family protein contai... 40 0.002 At5g22850.1 68418.m02671 aspartyl protease family protein contai... 40 0.002 At3g61820.1 68416.m06939 aspartyl protease family protein contai... 39 0.004 At3g51340.1 68416.m05620 aspartyl protease family protein contai... 39 0.004 At2g36670.1 68415.m04497 aspartyl protease family protein contai... 39 0.004 At2g23945.1 68415.m02859 chloroplast nucleoid DNA-binding protei... 39 0.004 At2g28220.1 68415.m03426 aspartyl protease family protein contai... 38 0.007 At3g52500.1 68416.m05773 aspartyl protease family protein contai... 38 0.009 At2g28030.1 68415.m03397 aspartyl protease family protein contai... 38 0.009 At1g65240.1 68414.m07396 aspartyl protease family protein contai... 38 0.009 At5g33340.1 68418.m03957 aspartyl protease family protein contai... 37 0.012 At3g25700.1 68416.m03198 chloroplast nucleoid DNA-binding protei... 37 0.012 At3g20015.1 68416.m02532 aspartyl protease family protein contai... 37 0.012 At2g28040.1 68415.m03399 aspartyl protease family protein contai... 37 0.012 At1g64830.1 68414.m07350 aspartyl protease family protein contai... 37 0.012 At5g43100.1 68418.m05261 aspartyl protease family protein low si... 36 0.022 At3g51360.1 68416.m05624 aspartyl protease family protein contai... 36 0.022 At3g18490.1 68416.m02350 aspartyl protease family protein contai... 36 0.022 At1g66180.1 68414.m07512 aspartyl protease family protein contai... 36 0.022 At1g01300.1 68414.m00046 aspartyl protease family protein contai... 36 0.022 At3g59080.1 68416.m06586 aspartyl protease family protein contai... 36 0.029 At3g50050.1 68416.m05472 aspartyl protease family protein contai... 36 0.038 At3g02740.1 68416.m00266 aspartyl protease family protein contai... 36 0.038 At2g42980.1 68415.m05332 aspartyl protease family protein contai... 36 0.038 At5g02190.1 68418.m00140 aspartyl protease family protein contai... 35 0.050 At4g35880.1 68417.m05095 aspartyl protease family protein contai... 35 0.066 At1g44130.1 68414.m05097 nucellin protein, putative similar to n... 35 0.066 At2g17760.1 68415.m02057 aspartyl protease family protein contai... 34 0.088 At5g10760.1 68418.m01250 aspartyl protease family protein contai... 34 0.12 At3g51330.1 68416.m05619 aspartyl protease family protein contai... 34 0.12 At1g77480.2 68414.m09023 nucellin protein, putative similar to n... 33 0.15 At1g77480.1 68414.m09022 nucellin protein, putative similar to n... 33 0.15 At5g07030.1 68418.m00796 aspartyl protease family protein contai... 33 0.20 At2g39710.1 68415.m04872 aspartyl protease family protein contai... 33 0.27 At1g09750.1 68414.m01094 chloroplast nucleoid DNA-binding protei... 33 0.27 At5g10770.1 68418.m01252 chloroplast nucleoid DNA-binding protei... 32 0.35 At3g54400.1 68416.m06015 aspartyl protease family protein contai... 31 0.62 At5g37540.1 68418.m04521 aspartyl protease family protein weak s... 31 0.82 At2g03200.1 68415.m00273 aspartyl protease family protein contai... 31 0.82 At1g25510.1 68414.m03168 aspartyl protease family protein contai... 31 0.82 At4g33490.1 68417.m04756 nucellin protein, putative similar to n... 31 1.1 At4g30030.1 68417.m04273 aspartyl protease family protein contai... 29 3.3 At1g52190.1 68414.m05889 proton-dependent oligopeptide transport... 29 4.4 At1g03220.1 68414.m00300 extracellular dermal glycoprotein, puta... 29 4.4 At4g30040.1 68417.m04274 aspartyl protease family contains Pfam ... 28 5.8 At5g42880.1 68418.m05226 hypothetical protein contains Pfam prof... 28 7.6 At4g24020.1 68417.m03452 RWP-RK domain-containing protein simila... 28 7.6 At1g71270.1 68414.m08225 Vps52/Sac2 family protein similar to SP... 28 7.6 >At1g62290.1 68414.m07027 aspartyl protease family protein contains Pfam profiles: PF00026 eukaryotic aspartyl protease, PF03489 surfactant protein B, PF05184 saposin-like type B, region 1 Length = 513 Score = 173 bits (421), Expect = 1e-43 Identities = 90/162 (55%), Positives = 106/162 (65%), Gaps = 3/162 (1%) Frame = +2 Query: 263 PLSNYLDAQYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKCHYTNIACLLHNKYDSRKSK 442 PL NYLDAQYYG I+IGTPPQ F V+FDTGSSNLWVPS KC ++ ++C H KY S +S Sbjct: 80 PLKNYLDAQYYGEIAIGTPPQKFTVIFDTGSSNLWVPSGKCFFS-LSCYFHAKYKSSRSS 138 Query: 443 TYVANGTQFAIQYGSGSLSGFLSTDDVTVGGLKVRRQTFAEAVSEPGLAFVAAKFDGILR 622 TY +G + AI YGSGS+SGF S D VTVG L V+ Q F E SEPGL F+ AKFDG+L Sbjct: 139 TYKKSGKRAAIHYGSGSISGFFSYDAVTVGDLVVKDQEFIETTSEPGLTFLVAKFDGLLG 198 Query: 623 DGLQHYRSGPCDPRCSTTWW--LKGPRAARS-FSFYXNRGPR 739 G Q G P W+ LK R FSF+ NR P+ Sbjct: 199 LGFQEIAVGNATP----VWYNMLKQGLIKRPVFSFWLNRDPK 236 >At1g11910.1 68414.m01374 aspartyl protease family protein contains Pfam profiles: PF00026 eukaryotic aspartyl protease, PF03489 surfactant protein B, PF05184 saposin-like type B, region 1 Length = 506 Score = 173 bits (421), Expect = 1e-43 Identities = 91/158 (57%), Positives = 105/158 (66%), Gaps = 3/158 (1%) Frame = +2 Query: 266 LSNYLDAQYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKCHYTNIACLLHNKYDSRKSKT 445 L NYLDAQYYG I+IGTPPQ F VVFDTGSSNLWVPS KC+++ +ACLLH KY S +S T Sbjct: 74 LKNYLDAQYYGEIAIGTPPQKFTVVFDTGSSNLWVPSSKCYFS-LACLLHPKYKSSRSST 132 Query: 446 YVANGTQFAIQYGSGSLSGFLSTDDVTVGGLKVRRQTFAEAVSEPGLAFVAAKFDGILRD 625 Y NG AI YG+G+++GF S D VTVG L V+ Q F EA EPG+ FV AKFDGIL Sbjct: 133 YEKNGKAAAIHYGTGAIAGFFSNDAVTVGDLVVKDQEFIEATKEPGITFVVAKFDGILGL 192 Query: 626 GLQHYRSGPCDPRCSTTWW--LK-GPRAARSFSFYXNR 730 G Q G P W+ LK G FSF+ NR Sbjct: 193 GFQEISVGKAAP----VWYNMLKQGLIKEPVFSFWLNR 226 >At4g04460.1 68417.m00648 aspartyl protease family protein contains Pfam profiles: PF00026 eukaryotic aspartyl protease, PF03489 surfactant protein B, PF05184 saposin-like type B, region 1 Length = 508 Score = 171 bits (417), Expect = 3e-43 Identities = 84/162 (51%), Positives = 107/162 (66%), Gaps = 3/162 (1%) Frame = +2 Query: 263 PLSNYLDAQYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKCHYTNIACLLHNKYDSRKSK 442 PL NYLDAQYYG I+IGTPPQ F V+FDTGSSNLW+PS KC Y ++AC H+KY + +S Sbjct: 78 PLKNYLDAQYYGDITIGTPPQKFTVIFDTGSSNLWIPSTKC-YLSVACYFHSKYKASQSS 136 Query: 443 TYVANGTQFAIQYGSGSLSGFLSTDDVTVGGLKVRRQTFAEAVSEPGLAFVAAKFDGILR 622 +Y NG +I+YG+G++SG+ S DDV VG + V+ Q F EA SEPG+ F+ AKFDGIL Sbjct: 137 SYRKNGKPASIRYGTGAISGYFSNDDVKVGDIVVKEQEFIEATSEPGITFLLAKFDGILG 196 Query: 623 DGLQHYRSGPCDPRCSTTWW---LKGPRAARSFSFYXNRGPR 739 G + G P W+ KG FSF+ NR P+ Sbjct: 197 LGFKEISVGNSTP----VWYNMVEKGLVKEPIFSFWLNRNPK 234 >At4g22050.1 68417.m03189 aspartyl protease family protein contains Pfam profile: PF00026 eukaryotic aspartyl protease Length = 354 Score = 110 bits (264), Expect = 1e-24 Identities = 59/119 (49%), Positives = 74/119 (62%), Gaps = 1/119 (0%) Frame = +2 Query: 266 LSNYLDAQYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKCHYTNIACLLHNKYDSRKSKT 445 L N D YYG I IG P Q+F V+FDTGSS+LWVPS+ ++ N+Y S S+T Sbjct: 38 LKNVKDFLYYGKIQIGNPGQTFTVLFDTGSSSLWVPSE--NWLAKTENPRNRYISSASRT 95 Query: 446 YVANGTQFAIQYGSGSLSGFLSTDDVTVGGLKVRRQTFAEAVSEPGLAFV-AAKFDGIL 619 + NGT+ ++YG GSL+GFLS D VTVGG+ + QTF E V P F FDGIL Sbjct: 96 FKENGTKAELKYGKGSLTGFLSVDTVTVGGISITSQTFIEGVKTPYKEFFKKMPFDGIL 154 >At1g69100.1 68414.m07907 aspartyl protease family protein contains Pfam profile: PF00026 eukaryotic aspartyl protease Length = 343 Score = 97.5 bits (232), Expect = 8e-21 Identities = 57/145 (39%), Positives = 83/145 (57%), Gaps = 1/145 (0%) Frame = +2 Query: 215 LELLRLKYDVTGPSPEPLSNYLDAQYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKCHYT 394 + L R +V G S L N+ +YG IS+G+PPQ F VVFDTGS++LWVPSK+ + Sbjct: 22 ISLKRHTLNVGGTSFGGLKNFDGVVFYGEISVGSPPQKFNVVFDTGSTDLWVPSKE--WP 79 Query: 395 NIACLLHNKYDSRKSKT-YVANGTQFAIQYGSGSLSGFLSTDDVTVGGLKVRRQTFAEAV 571 H K+D SKT + G + I Y +GS+ G L+ D+V VGG+ ++ Q A Sbjct: 80 EETDHKHPKFDKDASKTCRLMKGGEVNIAYETGSVVGILAQDNVNVGGVVIKSQDLFLA- 138 Query: 572 SEPGLAFVAAKFDGILRDGLQHYRS 646 P F + KFDG++ G++ R+ Sbjct: 139 RNPDTYFRSVKFDGVIGLGIKSSRA 163 >At3g42550.1 68416.m04414 aspartyl protease family protein weak similarity to CND41, chloroplast nucleoid DNA binding protein [Nicotiana tabacum] GI:2541876; contains Pfam profile PF00026: Eukaryotic aspartyl protease Length = 356 Score = 48.0 bits (109), Expect = 7e-06 Identities = 22/47 (46%), Positives = 26/47 (55%) Frame = +2 Query: 278 LDAQYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKCHYTNIACLLHN 418 L A YY + IGTPP+ VV DTGS +WV C + C LHN Sbjct: 74 LSALYYTTVQIGTPPRELDVVIDTGSDLVWVSCNSC----VGCPLHN 116 >At3g51350.1 68416.m05622 aspartyl protease family protein contains Eukaryotic and viral aspartyl proteases active site, PROSITE:PS00141 Length = 528 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/32 (53%), Positives = 21/32 (65%) Frame = +2 Query: 278 LDAQYYGVISIGTPPQSFKVVFDTGSSNLWVP 373 L + YY +S+GTPP SF V DTGS W+P Sbjct: 98 LGSLYYANVSVGTPPSSFLVALDTGSDLFWLP 129 >At1g31450.1 68414.m03851 aspartyl protease family protein contains eukaryotic and viral aspartyl proteases active site, PROSITE:PS00141 Length = 445 Score = 43.2 bits (97), Expect = 2e-04 Identities = 23/56 (41%), Positives = 28/56 (50%), Gaps = 2/56 (3%) Frame = +2 Query: 287 QYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKCHYTNIACLLHNK--YDSRKSKTY 448 +Y+ ISIGTPP + DTGS WV K C C N +D +KS TY Sbjct: 84 EYFMSISIGTPPSKVFAIADTGSDLTWVQCKPCQ----QCYKQNSPLFDKKKSSTY 135 >At5g45120.1 68418.m05539 aspartyl protease family protein contains Pfam profile: PF00026 eukaryotic aspartyl protease Length = 491 Score = 42.3 bits (95), Expect = 3e-04 Identities = 21/49 (42%), Positives = 26/49 (53%) Frame = +2 Query: 260 EPLSNYLDAQYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKCHYTNIAC 406 EPL D Y ++IGTPPQ+ +V DTGS WVP + I C Sbjct: 74 EPLREVRDG-YLITLNIGTPPQAVQVYLDTGSDLTWVPCGNLSFDCIEC 121 >At1g08210.1 68414.m00907 aspartyl protease family protein contains Pfam profile PF00026: Eukaryotic aspartyl protease; similar to CND41, chloroplast nucleoid DNA binding protein (GI:2541876) {Nicotiana tabacum} Length = 492 Score = 42.3 bits (95), Expect = 3e-04 Identities = 17/38 (44%), Positives = 22/38 (57%) Frame = +2 Query: 275 YLDAQYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKCH 388 +L YY + +GTPP+ F V DTGS LWV C+ Sbjct: 79 FLVGLYYTKVKLGTPPREFNVQIDTGSDVLWVSCTSCN 116 >At1g05840.1 68414.m00611 aspartyl protease family protein contains Pfam PF00026: Eukaryotic aspartyl protease Length = 485 Score = 41.1 bits (92), Expect = 8e-04 Identities = 28/77 (36%), Positives = 34/77 (44%), Gaps = 6/77 (7%) Frame = +2 Query: 290 YYGVISIGTPPQSFKVVFDTGSSNLWVPSKKCHY------TNIACLLHNKYDSRKSKTYV 451 YY I IGTP +S+ V DTGS +WV +C I L+N D S V Sbjct: 80 YYAKIGIGTPAKSYYVQVDTGSDIMWVNCIQCKQCPRRSTLGIELTLYN-IDESDSGKLV 138 Query: 452 ANGTQFAIQYGSGSLSG 502 + F Q G LSG Sbjct: 139 SCDDDFCYQISGGPLSG 155 >At2g35615.1 68415.m04367 aspartyl protease family protein contains Pfam domain, PF00026: eukaryotic aspartyl protease Length = 447 Score = 40.7 bits (91), Expect = 0.001 Identities = 22/58 (37%), Positives = 29/58 (50%), Gaps = 2/58 (3%) Frame = +2 Query: 281 DAQYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKCHYTNIACLLHNK--YDSRKSKTY 448 D +++ I+IGTPP + DTGS WV K C C N +D +KS TY Sbjct: 82 DGEFFMSITIGTPPIKVFAIADTGSDLTWVQCKPCQ----QCYKENGPIFDKKKSSTY 135 >At5g10080.1 68418.m01168 aspartyl protease family protein contains Eukaryotic and viral aspartyl proteases active site, PROSITE:PS00141 Length = 528 Score = 40.3 bits (90), Expect = 0.001 Identities = 22/51 (43%), Positives = 27/51 (52%) Frame = +2 Query: 290 YYGVISIGTPPQSFKVVFDTGSSNLWVPSKKCHYTNIACLLHNKYDSRKSK 442 +Y I IGTP SF V DTGS+ LW+P C+ A L Y S +K Sbjct: 100 HYTWIDIGTPSVSFLVALDTGSNLLWIP---CNCVQCAPLTSTYYSSLATK 147 >At3g12700.1 68416.m01587 aspartyl protease family protein contains Pfam PF00026: Eukaryotic aspartyl protease; similar to CND41, chloroplast nucleoid DNA binding protein (GI:2541876) [Nicotiana tabacum] Length = 461 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/40 (47%), Positives = 24/40 (60%) Frame = +2 Query: 272 NYLDAQYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKCHY 391 +Y AQY+ I +GTP + F+VV DTGS WV C Y Sbjct: 100 DYGTAQYFTEIRVGTPAKKFRVVVDTGSELTWV---NCRY 136 >At2g36670.2 68415.m04498 aspartyl protease family protein contains Pfam profile: PF00026 eukaryotic aspartyl protease Length = 507 Score = 39.9 bits (89), Expect = 0.002 Identities = 16/37 (43%), Positives = 20/37 (54%) Frame = +2 Query: 275 YLDAQYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKC 385 YL Y+ + +G+PP F V DTGS LWV C Sbjct: 95 YLVGLYFTKVKLGSPPTEFNVQIDTGSDILWVTCSSC 131 >At2g28010.1 68415.m03394 aspartyl protease family protein contains Pfam domain, PF00026: eukaryotic aspartyl protease Length = 396 Score = 39.9 bits (89), Expect = 0.002 Identities = 25/105 (23%), Positives = 48/105 (45%), Gaps = 4/105 (3%) Frame = +2 Query: 227 RLKYDVTGPSPEPLSNYLDAQYYGVISIGTPPQSFKVVFDTGSSNLW---VPSKKCHYTN 397 R+ +G SP + + ++ Y + +GTPP + + DTGS W +P C+ N Sbjct: 44 RVSNTQSGSSPYANTVFDNSVYLMKLQVGTPPFEIQAIIDTGSEITWTQCLPCVHCYEQN 103 Query: 398 IACLLHNKYDSRKSKTYVANGTQFAIQYGSGSLS-GFLSTDDVTV 529 +K + K K + + + Y + + G L+T+ +T+ Sbjct: 104 APIFDPSKSSTFKEKRCDGHSCPYEVDYFDHTYTMGTLATETITL 148 >At5g36260.1 68418.m04374 aspartyl protease family protein contains Pfam profile: PF00026 eukaryotic aspartyl protease Length = 482 Score = 39.5 bits (88), Expect = 0.002 Identities = 21/55 (38%), Positives = 29/55 (52%), Gaps = 3/55 (5%) Frame = +2 Query: 290 YYGVISIGTPPQSFKVVFDTGSSNLWV---PSKKCHYTNIACLLHNKYDSRKSKT 445 Y+ I +G+PP+ + V DTGS LWV P KC + + YDS+ S T Sbjct: 78 YFTKIKLGSPPKEYYVQVDTGSDILWVNCAPCPKCPVKTDLGIPLSLYDSKTSST 132 >At5g22850.1 68418.m02671 aspartyl protease family protein contains Pfam profile: PF00026 eukaryotic aspartyl protease Length = 493 Score = 39.5 bits (88), Expect = 0.002 Identities = 16/33 (48%), Positives = 20/33 (60%) Frame = +2 Query: 290 YYGVISIGTPPQSFKVVFDTGSSNLWVPSKKCH 388 YY + +GTPP+ F V DTGS LWV C+ Sbjct: 81 YYTKLRLGTPPRDFYVQVDTGSDVLWVSCASCN 113 >At3g61820.1 68416.m06939 aspartyl protease family protein contains Pfam domain, PF00026: eukaryotic aspartyl protease Length = 483 Score = 38.7 bits (86), Expect = 0.004 Identities = 36/136 (26%), Positives = 56/136 (41%), Gaps = 21/136 (15%) Frame = +2 Query: 287 QYYGVISIGTPPQSFKVVFDTGSSNLWV---PSKKCH--------------YTNIAC--- 406 +Y+ + +GTP + +V DTGS +W+ P K C+ + + C Sbjct: 134 EYFMRLGVGTPATNVYMVLDTGSDVVWLQCSPCKACYNQTDAIFDPKKSKTFATVPCGSR 193 Query: 407 LLHNKYDSRKSKTYVANGTQFAIQYGSGSLS-GFLSTDDVTVGGLKVRRQTFAEAVSEPG 583 L DS + T + + + YG GS + G ST+ +T G +V G Sbjct: 194 LCRRLDDSSECVTRRSKTCLYQVSYGDGSFTEGDFSTETLTFHGARVDHVPLGCGHDNEG 253 Query: 584 LAFVAAKFDGILRDGL 631 L AA G+ R GL Sbjct: 254 LFVGAAGLLGLGRGGL 269 >At3g51340.1 68416.m05620 aspartyl protease family protein contains Eukaryotic and viral aspartyl proteases active site, PROSITE:PS00141 Length = 518 Score = 38.7 bits (86), Expect = 0.004 Identities = 23/62 (37%), Positives = 33/62 (53%) Frame = +2 Query: 272 NYLDAQYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKCHYTNIACLLHNKYDSRKSKTYV 451 N+L +Y +S+GTP F V DTGS W+P C T C +H+ D+R S++ Sbjct: 85 NFLGFLHYANVSLGTPATWFLVALDTGSDLFWLPC-NCGTT---C-IHDLKDARFSESVP 139 Query: 452 AN 457 N Sbjct: 140 LN 141 >At2g36670.1 68415.m04497 aspartyl protease family protein contains Pfam profile: PF00026 eukaryotic aspartyl protease Length = 512 Score = 38.7 bits (86), Expect = 0.004 Identities = 18/51 (35%), Positives = 26/51 (50%), Gaps = 1/51 (1%) Frame = +2 Query: 236 YDVTGPS-PEPLSNYLDAQYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKC 385 + V G S P + + + Y+ + +G+PP F V DTGS LWV C Sbjct: 86 FPVQGSSDPYLVGSKMTMLYFTKVKLGSPPTEFNVQIDTGSDILWVTCSSC 136 >At2g23945.1 68415.m02859 chloroplast nucleoid DNA-binding protein-related contains weak similarity to GP|2541876|dbj|BAA22813.1||D26015 CND41, chloroplast nucleoid DNA binding protein {Nicotiana tabacum} Length = 458 Score = 38.7 bits (86), Expect = 0.004 Identities = 16/49 (32%), Positives = 27/49 (55%) Frame = +2 Query: 305 SIGTPPQSFKVVFDTGSSNLWVPSKKCHYTNIACLLHNKYDSRKSKTYV 451 S+G PP + DTGSS LW+ + C + + ++H ++ S T+V Sbjct: 101 SVGQPPVPQLTIMDTGSSLLWIQCQPCKHCSSDHMIHPVFNPALSSTFV 149 >At2g28220.1 68415.m03426 aspartyl protease family protein contains Pfam domain, PF00026: eukaryotic aspartyl protease Length = 756 Score = 37.9 bits (84), Expect = 0.007 Identities = 32/126 (25%), Positives = 50/126 (39%), Gaps = 4/126 (3%) Frame = +2 Query: 248 GPSPEPLSNYLDAQYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKCH--YTNIACLLH-N 418 G SP + Y + Y + +GTPP DTGS +W C Y+ A + + Sbjct: 407 GASPYADTLYDYSIYLMKLQVGTPPFEIVAEIDTGSDIIWTQCMPCPNCYSQFAPIFDPS 466 Query: 419 KYDSRKSKTYVANGTQFAIQYGSGSLS-GFLSTDDVTVGGLKVRRQTFAEAVSEPGLAFV 595 K + + + N + I Y + S G L+T+ VT+ AE GL Sbjct: 467 KSSTFREQRCNGNSCHYEIIYADKTYSKGILATETVTIPSTSGEPFVMAETKIGCGLDNT 526 Query: 596 AAKFDG 613 ++ G Sbjct: 527 NLQYSG 532 Score = 31.9 bits (69), Expect = 0.47 Identities = 31/124 (25%), Positives = 45/124 (36%), Gaps = 6/124 (4%) Frame = +2 Query: 233 KYDVTGPSPEPLSNYLDAQYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKCHYTNIACLL 412 K + G SP + + Y + +GTPP DTGS +W C + Sbjct: 63 KNQLQGASPYADTLFDYNIYLMKLQVGTPPFEIAAEIDTGSDLIWTQCMPC--PDCYSQF 120 Query: 413 HNKYDSRKSKTY-----VANGTQFAIQYGSGSLS-GFLSTDDVTVGGLKVRRQTFAEAVS 574 +D KS T+ + I Y + S G L+T+ VT+ AE Sbjct: 121 DPIFDPSKSSTFNEQRCHGKSCHYEIIYEDNTYSKGILATETVTIHSTSGEPFVMAETTI 180 Query: 575 EPGL 586 GL Sbjct: 181 GCGL 184 >At3g52500.1 68416.m05773 aspartyl protease family protein contains Pfam PF00026: eukaryotic aspartyl protease Length = 469 Score = 37.5 bits (83), Expect = 0.009 Identities = 18/37 (48%), Positives = 22/37 (59%) Frame = +2 Query: 263 PLSNYLDAQYYGVISIGTPPQSFKVVFDTGSSNLWVP 373 PLS Y +S GTP Q+ VFDTGSS +W+P Sbjct: 81 PLSAKSYGGYSVSLSFGTPSQTIPFVFDTGSSLVWLP 117 >At2g28030.1 68415.m03397 aspartyl protease family protein contains Pfam domain, PF00026: eukaryotic aspartyl protease Length = 392 Score = 37.5 bits (83), Expect = 0.009 Identities = 29/103 (28%), Positives = 43/103 (41%), Gaps = 4/103 (3%) Frame = +2 Query: 233 KYDVTGPSPEPLSNYLDAQYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKCH--YTNIAC 406 K + G SP + + Y + +GTPP + DTGS +W C Y+ A Sbjct: 42 KNQLQGASPYADTLFDYNIYLMKLQVGTPPFEIEAEIDTGSDLIWTQCMPCTNCYSQYAP 101 Query: 407 LLHNKYDSR-KSKTYVANGTQFAIQYGSGSLS-GFLSTDDVTV 529 + S K K N + I Y + S G L+T+ VT+ Sbjct: 102 IFDPSNSSTFKEKRCNGNSCHYKIIYADTTYSKGTLATETVTI 144 >At1g65240.1 68414.m07396 aspartyl protease family protein contains Pfam PF00026: Eukaryotic aspartyl protease profile; similar to CND41, chloroplast nucleoid DNA binding protein (GI:2541876) [Nicotiana tabacum] Length = 475 Score = 37.5 bits (83), Expect = 0.009 Identities = 14/32 (43%), Positives = 20/32 (62%) Frame = +2 Query: 290 YYGVISIGTPPQSFKVVFDTGSSNLWVPSKKC 385 Y+ I +G+PP+ + V DTGS LW+ K C Sbjct: 74 YFTKIKLGSPPKEYHVQVDTGSDILWINCKPC 105 >At5g33340.1 68418.m03957 aspartyl protease family protein contains Pfam domain, PF00026: eukaryotic aspartyl protease Length = 437 Score = 37.1 bits (82), Expect = 0.012 Identities = 23/68 (33%), Positives = 30/68 (44%), Gaps = 2/68 (2%) Frame = +2 Query: 251 PSPEPLSNYLDAQYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKCH--YTNIACLLHNKY 424 P P+ +Y +SIGTPP + DTGS LW C YT + L + Sbjct: 77 PQPQIDLTSNSGEYLMNVSIGTPPFPIMAIADTGSDLLWTQCAPCDDCYTQVDPL----F 132 Query: 425 DSRKSKTY 448 D + S TY Sbjct: 133 DPKTSSTY 140 >At3g25700.1 68416.m03198 chloroplast nucleoid DNA-binding protein-related contains weak similarity to CND41, chloroplast nucleoid DNA binding protein (GI:2541876) [Nicotiana tabacum] Length = 452 Score = 37.1 bits (82), Expect = 0.012 Identities = 15/33 (45%), Positives = 20/33 (60%) Frame = +2 Query: 287 QYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKC 385 QY+ + IG PPQS ++ DTGS +WV C Sbjct: 83 QYFVDLRIGQPPQSLLLIADTGSDLVWVKCSAC 115 >At3g20015.1 68416.m02532 aspartyl protease family protein contains Pfam domain, PF00026: eukaryotic aspartyl protease Length = 386 Score = 37.1 bits (82), Expect = 0.012 Identities = 33/128 (25%), Positives = 56/128 (43%), Gaps = 18/128 (14%) Frame = +2 Query: 287 QYYGVISIGTPPQSFKVVFDTGSSNLWV---PSKKCH--------------YTNIACLLH 415 +Y+ I +G+PP+ +V D+GS +WV P K C+ YT ++C Sbjct: 46 EYFVRIGVGSPPRDQYMVIDSGSDMVWVQCQPCKLCYKQSDPVFDPAKSGSYTGVSC-GS 104 Query: 416 NKYDSRKSKTYVANGTQFAIQYGSGSLS-GFLSTDDVTVGGLKVRRQTFAEAVSEPGLAF 592 + D ++ + G ++ + YG GS + G L+ + +T VR G+ Sbjct: 105 SVCDRIENSGCHSGGCRYEVMYGDGSYTKGTLALETLTFAKTVVRNVAMGCGHRNRGMFI 164 Query: 593 VAAKFDGI 616 AA GI Sbjct: 165 GAAGLLGI 172 >At2g28040.1 68415.m03399 aspartyl protease family protein contains Pfam domain, PF00026: eukaryotic aspartyl protease Length = 395 Score = 37.1 bits (82), Expect = 0.012 Identities = 27/90 (30%), Positives = 41/90 (45%), Gaps = 9/90 (10%) Frame = +2 Query: 287 QYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKC-HYTNIACLLHNKYDSRKSKTYVA--- 454 +Y + IGTPP + V DTGS ++W C H N + +D KS T+ Sbjct: 64 EYLMKLQIGTPPFEIEAVLDTGSEHIWTQCLPCVHCYNQTAPI---FDPSKSSTFKEIRC 120 Query: 455 ----NGTQFAIQYGSGSLS-GFLSTDDVTV 529 + + + YG S + G L T+ VT+ Sbjct: 121 DTHDHSCPYELVYGGKSYTKGTLVTETVTI 150 >At1g64830.1 68414.m07350 aspartyl protease family protein contains Pfam domain, PF00026: eukaryotic aspartyl protease Length = 431 Score = 37.1 bits (82), Expect = 0.012 Identities = 23/72 (31%), Positives = 32/72 (44%), Gaps = 2/72 (2%) Frame = +2 Query: 239 DVTGPSPEPLSNYLDAQYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKCH--YTNIACLL 412 D + SP+ +Y ISIGTPP + DTGS +W C Y + L Sbjct: 69 DASPNSPQSFITSNRGEYLMNISIGTPPVPILAIADTGSDLIWTQCNPCEDCYQQTSPL- 127 Query: 413 HNKYDSRKSKTY 448 +D ++S TY Sbjct: 128 ---FDPKESSTY 136 >At5g43100.1 68418.m05261 aspartyl protease family protein low similarity to CND41, chloroplast nucleoid DNA binding protein [Nicotiana tabacum] GI:2541876; contains Pfam profile PF00026: Eukaryotic aspartyl protease Length = 631 Score = 36.3 bits (80), Expect = 0.022 Identities = 14/26 (53%), Positives = 18/26 (69%) Frame = +2 Query: 308 IGTPPQSFKVVFDTGSSNLWVPSKKC 385 IGTPPQ F ++ DTGS+ +VP C Sbjct: 82 IGTPPQEFALIVDTGSTVTYVPCSTC 107 >At3g51360.1 68416.m05624 aspartyl protease family protein contains Eukaryotic and viral aspartyl proteases active site, PROSITE:PS00141 Length = 488 Score = 36.3 bits (80), Expect = 0.022 Identities = 18/53 (33%), Positives = 28/53 (52%) Frame = +2 Query: 290 YYGVISIGTPPQSFKVVFDTGSSNLWVPSKKCHYTNIACLLHNKYDSRKSKTY 448 +Y ++IGTP Q F V DTGS W+P C+ T + + ++ + K Y Sbjct: 89 HYANVTIGTPAQWFLVALDTGSDLFWLPC-NCNSTCVRSMETDQGERIKLNIY 140 >At3g18490.1 68416.m02350 aspartyl protease family protein contains Pfam domain, PF00026: eukaryotic aspartyl protease Length = 500 Score = 36.3 bits (80), Expect = 0.022 Identities = 29/99 (29%), Positives = 42/99 (42%), Gaps = 17/99 (17%) Frame = +2 Query: 287 QYYGVISIGTPPQSFKVVFDTGSSNLWV---PSKKCHYTNIACLLHNKYDSRKSKTYVA- 454 +Y+ I +GTP + +V DTGS W+ P C+ + + KS T A Sbjct: 161 EYFSRIGVGTPAKEMYLVLDTGSDVNWIQCEPCADCYQQSDPVFNPTSSSTYKSLTCSAP 220 Query: 455 ------------NGTQFAIQYGSGSLS-GFLSTDDVTVG 532 N + + YG GS + G L+TD VT G Sbjct: 221 QCSLLETSACRSNKCLYQVSYGDGSFTVGELATDTVTFG 259 >At1g66180.1 68414.m07512 aspartyl protease family protein contains Pfam PF00026: Eukaryotic aspartyl protease profile; similar to CND41, chloroplast nucleoid DNA binding protein (GI:2541876) [Nicotiana tabacum] Length = 430 Score = 36.3 bits (80), Expect = 0.022 Identities = 34/119 (28%), Positives = 52/119 (43%), Gaps = 7/119 (5%) Frame = +2 Query: 113 FFLALIASSVMALYRVPLHRMK-TARTHFHEVGTELELLRLKYDVTGPSPE-PLSNYLDA 286 FFL ++ S +PL + + T+ H T L L K PSP P N+ Sbjct: 12 FFLNYVSLSTSLSLHLPLTSLPISTTTNSHRFTTSL--LSRK----NPSPSSPPYNFRSR 65 Query: 287 QYYGV-----ISIGTPPQSFKVVFDTGSSNLWVPSKKCHYTNIACLLHNKYDSRKSKTY 448 Y + + IGTPPQ+ ++V DTGS W+ +CH + +D S ++ Sbjct: 66 FKYSMALIISLPIGTPPQAQQMVLDTGSQLSWI---QCHRKKLPPKPKTSFDPSLSSSF 121 >At1g01300.1 68414.m00046 aspartyl protease family protein contains Pfam domain, PF00026: eukaryotic aspartyl protease Length = 485 Score = 36.3 bits (80), Expect = 0.022 Identities = 19/57 (33%), Positives = 32/57 (56%), Gaps = 3/57 (5%) Frame = +2 Query: 287 QYYGVISIGTPPQSFKVVFDTGSSNLWV---PSKKCHYTNIACLLHNKYDSRKSKTY 448 +Y+ + +GTP + +V DTGS +W+ P ++C+ + +D RKSKTY Sbjct: 141 EYFTRLGVGTPARYVYMVLDTGSDIVWLQCAPCRRCYSQSDPI-----FDPRKSKTY 192 >At3g59080.1 68416.m06586 aspartyl protease family protein contains similarity to CND41, chloroplast nucleoid DNA binding protein (GI:2541876) [Nicotiana tabacum]; contains Pfam profile PF00026: Eukaryotic aspartyl protease Length = 535 Score = 35.9 bits (79), Expect = 0.029 Identities = 17/56 (30%), Positives = 29/56 (51%), Gaps = 2/56 (3%) Frame = +2 Query: 287 QYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKCHYTNIACLLHNK--YDSRKSKTY 448 +Y+ + +G+PP+ F ++ DTGS W+ C+ C N YD + S +Y Sbjct: 169 EYFMDVLVGSPPKHFSLILDTGSDLNWIQCLPCY----DCFQQNGAFYDPKASASY 220 >At3g50050.1 68416.m05472 aspartyl protease family protein contains Pfam PF00026: Eukaryotic aspartyl protease Length = 632 Score = 35.5 bits (78), Expect = 0.038 Identities = 20/59 (33%), Positives = 29/59 (49%), Gaps = 2/59 (3%) Frame = +2 Query: 278 LDAQYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKCHYTNIACLLHN--KYDSRKSKTY 448 ++ Y + IGTPPQ F ++ D+GS+ +VP C C H K+ S TY Sbjct: 89 INGYYTTRLWIGTPPQMFALIVDSGSTVTYVPCSDCE----QCGKHQDPKFQPEMSSTY 143 >At3g02740.1 68416.m00266 aspartyl protease family protein contains Pfam profile: PF00026 eukaryotic aspartyl protease Length = 488 Score = 35.5 bits (78), Expect = 0.038 Identities = 15/32 (46%), Positives = 18/32 (56%) Frame = +2 Query: 290 YYGVISIGTPPQSFKVVFDTGSSNLWVPSKKC 385 Y+ I +GTP + F V DTGS LWV C Sbjct: 85 YFAKIGLGTPSRDFHVQVDTGSDILWVNCAGC 116 >At2g42980.1 68415.m05332 aspartyl protease family protein contains pfam profile: PF00026 eukaryotic aspartyl protease Length = 527 Score = 35.5 bits (78), Expect = 0.038 Identities = 12/34 (35%), Positives = 21/34 (61%) Frame = +2 Query: 287 QYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKCH 388 +Y+ + +GTPP+ F ++ DTGS W+ C+ Sbjct: 159 EYFMDVLVGTPPKHFSLILDTGSDLNWLQCLPCY 192 >At5g02190.1 68418.m00140 aspartyl protease family protein contains Pfam profile PF00026: Eukaryotic aspartyl protease Length = 453 Score = 35.1 bits (77), Expect = 0.050 Identities = 16/49 (32%), Positives = 26/49 (53%) Frame = +2 Query: 302 ISIGTPPQSFKVVFDTGSSNLWVPSKKCHYTNIACLLHNKYDSRKSKTY 448 +++GTPPQ+ +V DTGS W+ + N N +D +S +Y Sbjct: 77 LTVGTPPQNISMVIDTGSELSWLRCNRSSNPNPV----NNFDPTRSSSY 121 >At4g35880.1 68417.m05095 aspartyl protease family protein contains Eukaryotic and viral aspartyl proteases active site, PROSITE:PS00141 Length = 524 Score = 34.7 bits (76), Expect = 0.066 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +2 Query: 290 YYGVISIGTPPQSFKVVFDTGSSNLWVP 373 +Y + +GTP F V DTGS WVP Sbjct: 107 HYTTVKLGTPGMRFMVALDTGSDLFWVP 134 >At1g44130.1 68414.m05097 nucellin protein, putative similar to nucellin GI:2290202 from [Hordeum vulgare] Length = 405 Score = 34.7 bits (76), Expect = 0.066 Identities = 18/38 (47%), Positives = 23/38 (60%), Gaps = 2/38 (5%) Frame = +2 Query: 263 PLS-NYLDAQYYGVI-SIGTPPQSFKVVFDTGSSNLWV 370 PLS N YY V+ IG+PP++F+ DTGS WV Sbjct: 38 PLSGNVFPLGYYSVLMQIGSPPKAFQFDIDTGSDLTWV 75 >At2g17760.1 68415.m02057 aspartyl protease family protein contains Eukaryotic and viral aspartyl proteases active site, PROSITE:PS00141 Length = 513 Score = 34.3 bits (75), Expect = 0.088 Identities = 15/36 (41%), Positives = 20/36 (55%) Frame = +2 Query: 290 YYGVISIGTPPQSFKVVFDTGSSNLWVPSKKCHYTN 397 +Y +++GTP F V DTGS W+P C TN Sbjct: 104 HYANVTVGTPSDWFMVALDTGSDLFWLP---CDCTN 136 >At5g10760.1 68418.m01250 aspartyl protease family protein contains Pfam domain, PF00026: eukaryotic aspartyl protease Length = 464 Score = 33.9 bits (74), Expect = 0.12 Identities = 14/32 (43%), Positives = 16/32 (50%) Frame = +2 Query: 290 YYGVISIGTPPQSFKVVFDTGSSNLWVPSKKC 385 Y I IGTP +VFDTGS W + C Sbjct: 132 YIVTIGIGTPKHDLSLVFDTGSDLTWTQCEPC 163 >At3g51330.1 68416.m05619 aspartyl protease family protein contains Eukaryotic and viral aspartyl proteases active site, PROSITE:PS00141 Length = 529 Score = 33.9 bits (74), Expect = 0.12 Identities = 13/28 (46%), Positives = 17/28 (60%) Frame = +2 Query: 290 YYGVISIGTPPQSFKVVFDTGSSNLWVP 373 +Y +S+GTP F V DTGS W+P Sbjct: 102 HYANVSVGTPATWFLVALDTGSDLFWLP 129 >At1g77480.2 68414.m09023 nucellin protein, putative similar to nucellin GB:AAB96882 GI:2290202 [Hordeum vulgare] (nucellin: similar to aspartic protease and its specific expression in nucellar cells during degeneration) Length = 432 Score = 33.5 bits (73), Expect = 0.15 Identities = 13/27 (48%), Positives = 18/27 (66%) Frame = +2 Query: 290 YYGVISIGTPPQSFKVVFDTGSSNLWV 370 YY +++IG PP+ F + DTGS WV Sbjct: 67 YYVLLNIGNPPKLFDLDIDTGSDLTWV 93 >At1g77480.1 68414.m09022 nucellin protein, putative similar to nucellin GB:AAB96882 GI:2290202 [Hordeum vulgare] (nucellin: similar to aspartic protease and its specific expression in nucellar cells during degeneration) Length = 466 Score = 33.5 bits (73), Expect = 0.15 Identities = 13/27 (48%), Positives = 18/27 (66%) Frame = +2 Query: 290 YYGVISIGTPPQSFKVVFDTGSSNLWV 370 YY +++IG PP+ F + DTGS WV Sbjct: 67 YYVLLNIGNPPKLFDLDIDTGSDLTWV 93 >At5g07030.1 68418.m00796 aspartyl protease family protein contains Pfam profile:PF00026 eukaryotic aspartyl protease Length = 439 Score = 33.1 bits (72), Expect = 0.20 Identities = 25/99 (25%), Positives = 39/99 (39%), Gaps = 15/99 (15%) Frame = +2 Query: 308 IGTPPQSFKVVFDTGSSNLWVPSKKC---------------HYTNIACLLHNKYDSRKSK 442 IGTP Q + DT S W+P C + N++C + + Sbjct: 105 IGTPAQPLLLAMDTSSDVAWIPCSGCVGCPSNTAFSPAKSTSFKNVSCSA-PQCKQVPNP 163 Query: 443 TYVANGTQFAIQYGSGSLSGFLSTDDVTVGGLKVRRQTF 559 T A F + YGS S++ LS D + + ++ TF Sbjct: 164 TCGARACSFNLTYGSSSIAANLSQDTIRLAADPIKAFTF 202 >At2g39710.1 68415.m04872 aspartyl protease family protein contains profile Pfam PF00026: Eukaryotic aspartyl protease; contains Prosite PS00141: Eukaryotic and viral aspartyl proteases active site.; Length = 442 Score = 32.7 bits (71), Expect = 0.27 Identities = 12/27 (44%), Positives = 18/27 (66%) Frame = +2 Query: 302 ISIGTPPQSFKVVFDTGSSNLWVPSKK 382 +++G PPQ+ +V DTGS W+ KK Sbjct: 69 LAVGDPPQNISMVLDTGSELSWLHCKK 95 >At1g09750.1 68414.m01094 chloroplast nucleoid DNA-binding protein-related contains Pfam profile PF00026: Eukaryotic aspartyl protease;b similar to CND41, chloroplast nucleoid DNA binding protein (GI:2541876) [Nicotiana tabacum] Length = 449 Score = 32.7 bits (71), Expect = 0.27 Identities = 20/65 (30%), Positives = 29/65 (44%), Gaps = 1/65 (1%) Frame = +2 Query: 257 PEPLSNYLDAQYYGV-ISIGTPPQSFKVVFDTGSSNLWVPSKKCHYTNIACLLHNKYDSR 433 P N L Y V +GTPPQ +V DT + +W+P C + A +++ Sbjct: 92 PVASGNQLHIGNYVVRAKLGTPPQLMFMVLDTSNDAVWLPCSGCSGCSNA---STSFNTN 148 Query: 434 KSKTY 448 S TY Sbjct: 149 SSSTY 153 >At5g10770.1 68418.m01252 chloroplast nucleoid DNA-binding protein, putative similar to CND41, chloroplast nucleoid DNA binding protein [Nicotiana tabacum] GI:2541876; contains Pfam profile PF00026: Eukaryotic aspartyl protease Length = 474 Score = 32.3 bits (70), Expect = 0.35 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = +2 Query: 290 YYGVISIGTPPQSFKVVFDTGSSNLWVPSKKC 385 Y + +GTP ++FDTGS W + C Sbjct: 132 YIVTVGLGTPKNDLSLIFDTGSDLTWTQCQPC 163 >At3g54400.1 68416.m06015 aspartyl protease family protein contains Pfam profile: PF00026 eukaryotic aspartyl protease Length = 425 Score = 31.5 bits (68), Expect = 0.62 Identities = 29/125 (23%), Positives = 48/125 (38%), Gaps = 16/125 (12%) Frame = +2 Query: 305 SIGTPPQSFKVVFDTGSSNLWVPSKKCHYTNIACLLHNKYDSRKSKTY------------ 448 +IGTP Q V DT + W+P C + + +L + S S+T Sbjct: 93 NIGTPAQPMLVALDTSNDAAWIPCSGCVGCS-SSVLFDPSKSSSSRTLQCEAPQCKQAPN 151 Query: 449 ----VANGTQFAIQYGSGSLSGFLSTDDVTVGGLKVRRQTFAEAVSEPGLAFVAAKFDGI 616 V+ F + YG ++ +L+ D +T+ + TF G + A G+ Sbjct: 152 PSCTVSKSCGFNMTYGGSTIEAYLTQDTLTLASDVIPNYTFGCINKASGTSLPAQGLMGL 211 Query: 617 LRDGL 631 R L Sbjct: 212 GRGPL 216 >At5g37540.1 68418.m04521 aspartyl protease family protein weak similarity to CND41, chloroplast nucleoid DNA binding protein [Nicotiana tabacum] GI:2541876; contains Prosite PS00141: Eukaryotic and viral aspartyl proteases active site; contains 1 predicted transmembrane domain Length = 442 Score = 31.1 bits (67), Expect = 0.82 Identities = 14/29 (48%), Positives = 19/29 (65%) Frame = +2 Query: 302 ISIGTPPQSFKVVFDTGSSNLWVPSKKCH 388 + IGTP QS ++V DTGS W+ +CH Sbjct: 84 LPIGTPSQSQELVLDTGSQLSWI---QCH 109 >At2g03200.1 68415.m00273 aspartyl protease family protein contains Pfam domain, PF00026: eukaryotic aspartyl protease Length = 461 Score = 31.1 bits (67), Expect = 0.82 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = +2 Query: 302 ISIGTPPQSFKVVFDTGSSNLWVPSKKC 385 +SIG P + + DTGS +W K C Sbjct: 111 LSIGNPAVKYSAIVDTGSDLIWTQCKPC 138 >At1g25510.1 68414.m03168 aspartyl protease family protein contains Pfam domain, PF00026: eukaryotic aspartyl protease Length = 483 Score = 31.1 bits (67), Expect = 0.82 Identities = 31/127 (24%), Positives = 49/127 (38%), Gaps = 17/127 (13%) Frame = +2 Query: 287 QYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKC----HYTN--IACLLHNKYDSRKSKTY 448 +Y+ + IG P + +V DTGS W+ C H T + Y+ T Sbjct: 147 EYFTRVGIGKPAREVYMVLDTGSDVNWLQCTPCADCYHQTEPIFEPSSSSSYEPLSCDTP 206 Query: 449 VANGTQ----------FAIQYGSGSLS-GFLSTDDVTVGGLKVRRQTFAEAVSEPGLAFV 595 N + + + YG GS + G +T+ +T+G V+ S GL Sbjct: 207 QCNALEVSECRNATCLYEVSYGDGSYTVGDFATETLTIGSTLVQNVAVGCGHSNEGLFVG 266 Query: 596 AAKFDGI 616 AA G+ Sbjct: 267 AAGLLGL 273 >At4g33490.1 68417.m04756 nucellin protein, putative similar to nucellin GI:2290202 from [Hordeum vulgare] Length = 425 Score = 30.7 bits (66), Expect = 1.1 Identities = 16/41 (39%), Positives = 23/41 (56%), Gaps = 1/41 (2%) Frame = +2 Query: 290 YYGV-ISIGTPPQSFKVVFDTGSSNLWVPSKKCHYTNIACL 409 YY V I+IG PP+ + + DTGS W+ +C + CL Sbjct: 59 YYNVTINIGQPPRPYYLDLDTGSDLTWL---QCDAPCVRCL 96 >At4g30030.1 68417.m04273 aspartyl protease family protein contains Pfam domain, PF00026: eukaryotic aspartyl protease Length = 424 Score = 29.1 bits (62), Expect = 3.3 Identities = 13/34 (38%), Positives = 17/34 (50%) Frame = +2 Query: 284 AQYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKC 385 A + ISIG PP ++ DTGS W+ C Sbjct: 76 AAFLANISIGNPPVPQLLLIDTGSDLTWIHCLPC 109 >At1g52190.1 68414.m05889 proton-dependent oligopeptide transport (POT) family protein contains Pfam profile: PF00854 POT family Length = 607 Score = 28.7 bits (61), Expect = 4.4 Identities = 14/52 (26%), Positives = 24/52 (46%) Frame = +2 Query: 302 ISIGTPPQSFKVVFDTGSSNLWVPSKKCHYTNIACLLHNKYDSRKSKTYVAN 457 +S+ SF + S + PS+K + N ACL+ N+ + S + N Sbjct: 264 LSLPDHHDSFDCYYHMKDSEIKAPSQKLRFLNKACLISNREEEIGSDGFALN 315 >At1g03220.1 68414.m00300 extracellular dermal glycoprotein, putative / EDGP, putative similar to extracellular dermal glycoprotein EDGP precursor [Daucus carota] GI:285741 Length = 433 Score = 28.7 bits (61), Expect = 4.4 Identities = 15/32 (46%), Positives = 16/32 (50%) Frame = +2 Query: 287 QYYGVISIGTPPQSFKVVFDTGSSNLWVPSKK 382 QY VI+ TP VVFD G LWV K Sbjct: 43 QYTTVINQRTPLVPASVVFDLGGRELWVDCDK 74 >At4g30040.1 68417.m04274 aspartyl protease family contains Pfam domain, PF00026: eukaryotic aspartyl protease Length = 427 Score = 28.3 bits (60), Expect = 5.8 Identities = 23/67 (34%), Positives = 31/67 (46%), Gaps = 2/67 (2%) Frame = +2 Query: 302 ISIGTPPQSFKVVFDTGSSNLWVPSKKCHYTNIACLLHNK--YDSRKSKTYVANGTQFAI 475 ISIG+PP + + DT S LW+ C I C + +D +S T+ N T Sbjct: 89 ISIGSPPITQLLHMDTASDLLWIQCLPC----INCYAQSLPIFDPSRSYTH-RNETCRTS 143 Query: 476 QYGSGSL 496 QY SL Sbjct: 144 QYSMPSL 150 >At5g42880.1 68418.m05226 hypothetical protein contains Pfam profile PF05701: Plant protein of unknown function (DUF827) Length = 751 Score = 27.9 bits (59), Expect = 7.6 Identities = 15/45 (33%), Positives = 22/45 (48%) Frame = -3 Query: 730 PVXIERERPGCTRSLEPPCCXTPGVTWSTAIVLKAIPEDPVELGG 596 P +E R G RS+E PC +P TA +++ E + GG Sbjct: 108 PRSVESPRFGSPRSVESPCFGSPIGVIDTASPFESVREAVSKFGG 152 >At4g24020.1 68417.m03452 RWP-RK domain-containing protein similar to nodule inception protein [Lotus japonicus] GI:6448579; contains Pfam profile: PF02042 RWP-RK domain Length = 959 Score = 27.9 bits (59), Expect = 7.6 Identities = 25/101 (24%), Positives = 42/101 (41%) Frame = +2 Query: 344 DTGSSNLWVPSKKCHYTNIACLLHNKYDSRKSKTYVANGTQFAIQYGSGSLSGFLSTDDV 523 + ++NL+ P K+ N+AC ++ T A+ I++ S SG + D Sbjct: 834 NNSNNNLYAPPKEEAIANVAC--EPSGSEMRTVTIKASYKDDIIRFRISSGSGIMELKDE 891 Query: 524 TVGGLKVRRQTFAEAVSEPGLAFVAAKFDGILRDGLQHYRS 646 LKV TF + +V D L++ L+ RS Sbjct: 892 VAKRLKVDAGTFDIKYLDDDNEWVLIACDADLQECLEIPRS 932 >At1g71270.1 68414.m08225 Vps52/Sac2 family protein similar to SP|P39904 SAC2 protein {Saccharomyces cerevisiae}; contains Pfam profile PF04129: Vps52 / Sac2 family Length = 707 Score = 27.9 bits (59), Expect = 7.6 Identities = 23/83 (27%), Positives = 39/83 (46%) Frame = +2 Query: 290 YYGVISIGTPPQSFKVVFDTGSSNLWVPSKKCHYTNIACLLHNKYDSRKSKTYVANGTQF 469 Y ++I P+ FK+VFD+ S+L + K + + +H Y R+ + A+ Sbjct: 454 YLDKVNISLWPR-FKMVFDSHLSSLRDANIKTLWEDD---VHPHYVMRRYAEFTASFIHL 509 Query: 470 AIQYGSGSLSGFLSTDDVTVGGL 538 ++YG G L L + V GL Sbjct: 510 NVEYGDGQLDINLERLRMAVDGL 532 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,612,896 Number of Sequences: 28952 Number of extensions: 356467 Number of successful extensions: 1093 Number of sequences better than 10.0: 64 Number of HSP's better than 10.0 without gapping: 1038 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1086 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1663169840 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -