BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0504 (750 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskel... 25 1.9 AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative different... 23 7.6 AF269153-1|AAF91398.1| 109|Anopheles gambiae labial homeotic pr... 23 7.6 >CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskeletal structural protein protein. Length = 1645 Score = 25.4 bits (53), Expect = 1.9 Identities = 17/45 (37%), Positives = 22/45 (48%) Frame = +1 Query: 304 PAKAAGTTQAKPLVAKVVVQAGHSNTDTSNQPAVLTKLLPSSNAG 438 PA AA ++ A LVAKV A ++ QP V S+ AG Sbjct: 1335 PANAAPSSPAGVLVAKVPPVAVEDIENSKQQPPVQQTAATSAAAG 1379 >AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative differentiation regulator protein. Length = 1283 Score = 23.4 bits (48), Expect = 7.6 Identities = 14/46 (30%), Positives = 19/46 (41%) Frame = +1 Query: 253 GATLQYVRANSDQAQLTPAKAAGTTQAKPLVAKVVVQAGHSNTDTS 390 GA L + S +P A + + P+VA G SNT S Sbjct: 728 GAPLALTSSKSASTHPSPHPATRASPSSPIVATSSSGGGGSNTPNS 773 >AF269153-1|AAF91398.1| 109|Anopheles gambiae labial homeotic protein protein. Length = 109 Score = 23.4 bits (48), Expect = 7.6 Identities = 20/77 (25%), Positives = 31/77 (40%), Gaps = 9/77 (11%) Frame = +1 Query: 406 LTKLLPSSNAGARYVMQQKTVPISIGNKVLLSSPTKQGVKKQQIIAVKSSSTKXFN---- 573 LTK L S ++ P+ + N + +P+ Q + ++ST N Sbjct: 5 LTKSLQLSTTPEYHIPTXVLDPLRVPNHTTVVAPSAVS-PHQSSFMINNNSTGRTNFTNK 63 Query: 574 -----EKSFHIGKFLTR 609 EK FH K+LTR Sbjct: 64 QLTELEKEFHFNKYLTR 80 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 715,558 Number of Sequences: 2352 Number of extensions: 14106 Number of successful extensions: 60 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 60 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 60 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 77339358 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -