BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0502 (708 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock prote... 24 1.1 U09586-3|AAC47272.1| 470|Tribolium castaneum integrase protein. 23 1.8 AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription fa... 23 2.4 AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B prot... 22 4.3 AY337337-2|AAP94193.1| 491|Tribolium castaneum cytochrome P450 ... 22 5.6 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 21 7.4 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 21 7.4 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 21 7.4 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 21 7.4 AF251548-1|AAF70178.1| 491|Tribolium castaneum cytochrome P450 ... 21 7.4 >EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock protein 90 protein. Length = 721 Score = 24.2 bits (50), Expect = 1.1 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = +2 Query: 611 NMDLSTLGXRFXLXSSMYNLINTFYSXKK 697 N D+ T + + M +INTFYS K+ Sbjct: 7 NGDVETFAFQAEIAQLMSLIINTFYSNKE 35 >U09586-3|AAC47272.1| 470|Tribolium castaneum integrase protein. Length = 470 Score = 23.4 bits (48), Expect = 1.8 Identities = 11/34 (32%), Positives = 14/34 (41%) Frame = -1 Query: 192 LSSAVHIRRTPSARTVESRQRSLSSYPNRRYGSW 91 LSS H PS R + R +Y + SW Sbjct: 286 LSSIRHPESNPSERVMRELGRIFRAYCRENHASW 319 >AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription factor protein. Length = 441 Score = 23.0 bits (47), Expect = 2.4 Identities = 9/30 (30%), Positives = 15/30 (50%) Frame = -3 Query: 175 YSSDTKCTHSGKSSTVALFLPKSKIRILGS 86 Y+ D CTH +++ P+S +GS Sbjct: 365 YNQDVSCTHYQNPEYISVVNPESPYPQIGS 394 >AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B protein. Length = 351 Score = 22.2 bits (45), Expect = 4.3 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -2 Query: 167 GHQVHAQWKVVN 132 GH +HAQ VVN Sbjct: 327 GHHIHAQHHVVN 338 >AY337337-2|AAP94193.1| 491|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 491 Score = 21.8 bits (44), Expect = 5.6 Identities = 9/21 (42%), Positives = 11/21 (52%) Frame = -1 Query: 174 IRRTPSARTVESRQRSLSSYP 112 I RTP + R+R L YP Sbjct: 48 IMRTPEQMFLADRERGLKYYP 68 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 21.4 bits (43), Expect = 7.4 Identities = 9/18 (50%), Positives = 10/18 (55%) Frame = +1 Query: 433 GGRHRSSRLCAVPSSSSP 486 G RSSR+C SS P Sbjct: 145 GSLFRSSRMCFFKSSKKP 162 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 21.4 bits (43), Expect = 7.4 Identities = 9/18 (50%), Positives = 10/18 (55%) Frame = +1 Query: 433 GGRHRSSRLCAVPSSSSP 486 G RSSR+C SS P Sbjct: 145 GSLFRSSRMCFFKSSKKP 162 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 21.4 bits (43), Expect = 7.4 Identities = 9/18 (50%), Positives = 10/18 (55%) Frame = +1 Query: 433 GGRHRSSRLCAVPSSSSP 486 G RSSR+C SS P Sbjct: 145 GSLFRSSRMCFFKSSKKP 162 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 21.4 bits (43), Expect = 7.4 Identities = 9/18 (50%), Positives = 10/18 (55%) Frame = +1 Query: 433 GGRHRSSRLCAVPSSSSP 486 G RSSR+C SS P Sbjct: 145 GSLFRSSRMCFFKSSKKP 162 >AF251548-1|AAF70178.1| 491|Tribolium castaneum cytochrome P450 monooxigenase CYP4Q4 protein. Length = 491 Score = 21.4 bits (43), Expect = 7.4 Identities = 9/21 (42%), Positives = 11/21 (52%) Frame = -1 Query: 174 IRRTPSARTVESRQRSLSSYP 112 I RTP + R+R L YP Sbjct: 48 IMRTPEQLFLAERERGLKYYP 68 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 174,619 Number of Sequences: 336 Number of extensions: 4025 Number of successful extensions: 11 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18738900 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -