BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0500 (700 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein ... 23 2.1 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 23 3.7 >AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein 1 protein. Length = 500 Score = 23.4 bits (48), Expect = 2.1 Identities = 15/41 (36%), Positives = 22/41 (53%), Gaps = 3/41 (7%) Frame = +3 Query: 282 GQEP---DECGRAHREGFVRRLHQVHPPGDHRVSDSGLAHE 395 G++P D CG++ V +LHQV G+ +V L HE Sbjct: 228 GEKPYTCDICGKSFGYNHVLKLHQVAHYGE-KVYKCTLCHE 267 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 22.6 bits (46), Expect = 3.7 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = +1 Query: 340 TKYTRQGTIASPIVVWRMKAPEKKPLIRPEKP 435 TK T T A+ R + KP ++P+KP Sbjct: 1100 TKETSTVTAAAAATNIRPGTADNKPQLKPQKP 1131 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 165,465 Number of Sequences: 438 Number of extensions: 3162 Number of successful extensions: 7 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21439440 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -