BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0499 (750 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF281078-1|AAF82131.1| 2051|Anopheles gambiae vitellogenin 1 pro... 24 5.8 AF387862-2|AAL56548.1| 942|Anopheles gambiae pol polyprotein pr... 23 7.6 >AF281078-1|AAF82131.1| 2051|Anopheles gambiae vitellogenin 1 protein. Length = 2051 Score = 23.8 bits (49), Expect = 5.8 Identities = 12/47 (25%), Positives = 24/47 (51%), Gaps = 1/47 (2%) Frame = +2 Query: 218 YKKLNFLDDILVDSTEDM-EAEESNQINEQKPKTEQEVITDNQEYYE 355 YK + D +S+ E+++SN + ++ K +E + Q+Y E Sbjct: 1915 YKDFDLSDSSSSESSSSSDESDDSNSSSSEERKPNREHFFEKQQYTE 1961 >AF387862-2|AAL56548.1| 942|Anopheles gambiae pol polyprotein protein. Length = 942 Score = 23.4 bits (48), Expect = 7.6 Identities = 15/46 (32%), Positives = 24/46 (52%) Frame = +2 Query: 227 LNFLDDILVDSTEDMEAEESNQINEQKPKTEQEVITDNQEYYEIRL 364 L ++DD+LV +ED E E+ N K + + D + Y IR+ Sbjct: 622 LLYVDDMLVACSEDREYEDIE--NTLKRHFKITTLGDVRNYLGIRI 665 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 736,162 Number of Sequences: 2352 Number of extensions: 16644 Number of successful extensions: 53 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 52 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 53 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 77339358 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -