BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0495 (750 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_03_1258 + 25244863-25245282,25246419-25246568,25246665-252468... 32 0.56 04_04_0420 + 25094018-25094202,25094909-25095203 31 0.74 >07_03_1258 + 25244863-25245282,25246419-25246568,25246665-25246877, 25246979-25247068,25247311-25247424,25247881-25248150, 25248251-25248407,25248691-25248741,25248742-25248819, 25249357-25249457,25249832-25250002,25250136-25250210, 25251527-25251793 Length = 718 Score = 31.9 bits (69), Expect = 0.56 Identities = 16/32 (50%), Positives = 19/32 (59%) Frame = +3 Query: 402 RKYVXFVLXTXRSMYGRXIEQLKQAXXTILSE 497 RK V FV+ T SM G +E +K A T LSE Sbjct: 332 RKAVVFVIDTSGSMQGHPLENVKNAMSTALSE 363 >04_04_0420 + 25094018-25094202,25094909-25095203 Length = 159 Score = 31.5 bits (68), Expect = 0.74 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = +3 Query: 48 HCHH*HSGSRTKSPN*GCRXSSTGNEIDATK 140 HCHH S +R+++PN G + G E+ K Sbjct: 20 HCHHHRSSARSRNPNFGRKGRVEGEELTGEK 50 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,177,942 Number of Sequences: 37544 Number of extensions: 231794 Number of successful extensions: 352 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 346 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 352 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1992480932 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -