BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0491 (750 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_03_0922 - 22612773-22613321,22613616-22614189,22614389-226144... 30 2.3 >07_03_0922 - 22612773-22613321,22613616-22614189,22614389-22614466, 22615455-22615504,22616215-22616448 Length = 494 Score = 29.9 bits (64), Expect = 2.3 Identities = 19/75 (25%), Positives = 34/75 (45%) Frame = -1 Query: 249 LHRKRAKLTSDCARHFDGKILDSQIKRLKTKTNPLIVCRRTQTILSTFQHFHDSKMEHCF 70 + RKR + RH D +IL S+IK T + ++ + + + + +EH Sbjct: 311 VQRKRTRYKKMIRRHIDFRILHSKIKSGATSSTKELLRDILLFVNNVLAFYPKATLEHMA 370 Query: 69 DSTIRNLAPRELSMS 25 +RN+A R + S Sbjct: 371 AIELRNIAFRTVQES 385 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,591,685 Number of Sequences: 37544 Number of extensions: 308237 Number of successful extensions: 561 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 552 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 561 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1992480932 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -