BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0490 (800 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC63.04 |mok14||alpha-1,3-glucan synthase Mok14|Schizosaccharo... 26 7.2 SPCC663.03 |pmd1||leptomycin efflux transporter Pmd1|Schizosacch... 25 9.5 >SPCC63.04 |mok14||alpha-1,3-glucan synthase Mok14|Schizosaccharomyces pombe|chr 3|||Manual Length = 1369 Score = 25.8 bits (54), Expect = 7.2 Identities = 19/60 (31%), Positives = 33/60 (55%) Frame = +3 Query: 486 ISIGHAYSPTIHCQGLVI*HFNRQKCGYRIIGRSNQYKLMSNSSAFIRNR*FFRSLKNIG 665 I G+A++ +HC + + R + GY ++G SN+Y +++R F+ SLK IG Sbjct: 447 IQFGNAFN-LMHCG---VSYVRRHQSGYGVVGVSNKY----GQRSWVRYPVFW-SLKKIG 497 >SPCC663.03 |pmd1||leptomycin efflux transporter Pmd1|Schizosaccharomyces pombe|chr 3|||Manual Length = 1362 Score = 25.4 bits (53), Expect = 9.5 Identities = 13/36 (36%), Positives = 21/36 (58%) Frame = -2 Query: 238 IGSESRSTVTIRRATQWAVYWLVLYI*SWVAASHSN 131 I ++ ST + + +AVYWL+L I + A + SN Sbjct: 822 IFTDLSSTDFLHKVNVFAVYWLILAIVQFFAYAISN 857 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,251,385 Number of Sequences: 5004 Number of extensions: 67239 Number of successful extensions: 125 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 120 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 125 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 388424860 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -