BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0488 (750 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF025470-4|AAB71054.1| 403|Caenorhabditis elegans Hypothetical ... 31 0.87 Z92835-5|CAB07398.1| 168|Caenorhabditis elegans Hypothetical pr... 29 4.7 >AF025470-4|AAB71054.1| 403|Caenorhabditis elegans Hypothetical protein W10D9.4 protein. Length = 403 Score = 31.1 bits (67), Expect = 0.87 Identities = 10/17 (58%), Positives = 15/17 (88%) Frame = +2 Query: 20 FDNYVKPLRLYLTKYRE 70 FDNY +P+R++L KYR+ Sbjct: 134 FDNYAEPMRIFLQKYRQ 150 >Z92835-5|CAB07398.1| 168|Caenorhabditis elegans Hypothetical protein H19N07.3 protein. Length = 168 Score = 28.7 bits (61), Expect = 4.7 Identities = 18/73 (24%), Positives = 38/73 (52%) Frame = +1 Query: 142 KTARPVFQTKMKSIHKLNPPFSTSQALIQKSLKNLFLHD*DCSGIKISFLRMCDRIMLVY 321 K + V KM ++ + S++L+++ +LF SG+ I +C++ +++ Sbjct: 29 KDDKDVVYEKMCTLQERTDILKVSKSLVEEKWSSLFSE----SGLHIE--EVCEKELVLT 82 Query: 322 FKIDQNIVLLKTE 360 F + +NI L +TE Sbjct: 83 FALQRNITLERTE 95 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,208,921 Number of Sequences: 27780 Number of extensions: 301310 Number of successful extensions: 634 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 621 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 634 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1777507862 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -