BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0487 (700 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_06_0565 + 34747278-34748066,34748170-34748406,34749777-347498... 33 0.22 04_04_0240 + 23851859-23851917,23852018-23852087,23852177-238533... 30 2.0 >03_06_0565 + 34747278-34748066,34748170-34748406,34749777-34749869, 34751752-34751988,34752398-34752584,34752956-34753028, 34753145-34753289,34753670-34753779,34754127-34754258, 34754328-34754469,34754545-34754679,34756278-34756435, 34757327-34757401,34757505-34757643,34757838-34757952, 34758016-34758107,34758500-34758613 Length = 990 Score = 33.1 bits (72), Expect = 0.22 Identities = 25/81 (30%), Positives = 39/81 (48%), Gaps = 3/81 (3%) Frame = +2 Query: 452 VSRVYYFRFIISGTSNTLQLSLLWTTKV---LFVIISILSLTIMEFSRKKKMLRFLRFIS 622 V + Y + S+T +L + WT K LFV IS+L + S L L + Sbjct: 820 VGHMVYMSGLTCTLSSTNKLEVAWTEKEPGSLFVNISLLPALLN--STCLHNLSLLSDLP 877 Query: 623 HRTNQ*HLLHLRLALNEANAI 685 H TN+ H+ H+RL + N++ Sbjct: 878 HSTNRTHICHVRLDHIDVNSL 898 >04_04_0240 + 23851859-23851917,23852018-23852087,23852177-23853394, 23853504-23854040 Length = 627 Score = 29.9 bits (64), Expect = 2.0 Identities = 14/41 (34%), Positives = 21/41 (51%) Frame = +2 Query: 167 ISTRLCGGLPAQQPGVTCDNAAARWLLIGARTHHAIRSQSG 289 ++ + G + A+ G T A RWL I A+ HHA +G Sbjct: 206 VAVKATGTVHAKAIGDTLKAYARRWLPIAAKNHHAAERTAG 246 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,438,856 Number of Sequences: 37544 Number of extensions: 285808 Number of successful extensions: 605 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 598 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 605 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1792053856 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -