BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0483 (714 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_03_0128 - 10437407-10438049,10438097-10438272 29 3.7 05_06_0212 + 26410330-26410419,26410562-26410846,26411005-264112... 29 4.8 06_03_0843 + 25315089-25315417,25317274-25317310,25317439-253176... 28 8.5 >11_03_0128 - 10437407-10438049,10438097-10438272 Length = 272 Score = 29.1 bits (62), Expect = 3.7 Identities = 18/47 (38%), Positives = 20/47 (42%) Frame = -2 Query: 656 SGYRRPMDFSNARGRAKPAAYRLILSTSLV*RRTCHRARETPERSCE 516 +G RP D AR R P R STS RTC RA C+ Sbjct: 112 AGIHRPDDGHRARQRHLPRRSRSTASTSSTTCRTCCRATPNSTSPCK 158 >05_06_0212 + 26410330-26410419,26410562-26410846,26411005-26411208, 26411636-26411692,26411859-26412926 Length = 567 Score = 28.7 bits (61), Expect = 4.8 Identities = 17/55 (30%), Positives = 30/55 (54%), Gaps = 6/55 (10%) Frame = +3 Query: 288 EIILSPFLI*SV--K*NTTDLFSQFNWSQRYT----WLPVSSSREKKSTEAKAPT 434 +++ SP L+ ++ + + D S FNW +R+T W P+S + T+AK T Sbjct: 212 KLLASPILVEALHFQYDERDPNSAFNWLERWTIGRVWRPISHPKRAAVTDAKPHT 266 >06_03_0843 + 25315089-25315417,25317274-25317310,25317439-25317675, 25317745-25317792,25318144-25318577,25318675-25318759 Length = 389 Score = 27.9 bits (59), Expect = 8.5 Identities = 15/31 (48%), Positives = 18/31 (58%) Frame = -3 Query: 619 GAEPSPLPTV*YSPQASFEEGHVIELGKHPR 527 G EP P P SP A+ E+G V+EL PR Sbjct: 23 GVEPPPSP----SPAAAAEDGAVVELSGVPR 49 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,477,403 Number of Sequences: 37544 Number of extensions: 409152 Number of successful extensions: 1047 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1021 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1046 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1851002996 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -