BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0479 (700 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value U26026-1|AAA69069.1| 377|Apis mellifera long-wavelength rhodops... 24 1.2 AY703752-1|AAU12748.1| 152|Apis mellifera long-wavelength rhodo... 24 1.2 AY398690-1|AAR83734.1| 416|Apis mellifera major royal jelly pro... 23 2.8 AB208107-1|BAE72139.1| 71|Apis mellifera Broad complex zinc fi... 22 4.9 >U26026-1|AAA69069.1| 377|Apis mellifera long-wavelength rhodopsin protein. Length = 377 Score = 24.2 bits (50), Expect = 1.2 Identities = 9/34 (26%), Positives = 18/34 (52%) Frame = -3 Query: 320 NLQICSKFYVWQYSLKQHVFQFCMS*QFSLSCYH 219 +L+ S +V ++ + FCMS ++CY+ Sbjct: 82 SLRTPSNLFVINLAISNFLMMFCMSPPMVINCYY 115 >AY703752-1|AAU12748.1| 152|Apis mellifera long-wavelength rhodopsin protein. Length = 152 Score = 24.2 bits (50), Expect = 1.2 Identities = 9/34 (26%), Positives = 18/34 (52%) Frame = -3 Query: 320 NLQICSKFYVWQYSLKQHVFQFCMS*QFSLSCYH 219 +L+ S +V ++ + FCMS ++CY+ Sbjct: 48 SLRTPSNLFVINLAISDFLMMFCMSPPMVINCYY 81 >AY398690-1|AAR83734.1| 416|Apis mellifera major royal jelly protein 8 protein. Length = 416 Score = 23.0 bits (47), Expect = 2.8 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = +2 Query: 146 QGVLPPPSEVVENGLKIVTEYKY 214 QGV S + N LK++ E+KY Sbjct: 15 QGVTDIHSRNLTNSLKVIYEWKY 37 >AB208107-1|BAE72139.1| 71|Apis mellifera Broad complex zinc finger domain-Z2 isoform protein. Length = 71 Score = 22.2 bits (45), Expect = 4.9 Identities = 13/37 (35%), Positives = 17/37 (45%), Gaps = 1/37 (2%) Frame = -3 Query: 314 QICSKFYVWQYSLKQHVFQFCMS*QFSLSCYHC-RIY 207 Q+C K + SLK+HV Q C C R+Y Sbjct: 9 QLCGKVLCSKASLKRHVADKHAERQEEYRCVICERVY 45 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 169,659 Number of Sequences: 438 Number of extensions: 3118 Number of successful extensions: 9 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21439440 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -