BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0475 (422 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1805.11c |rps2602|rps26-2|40S ribosomal protein S26|Schizosa... 159 2e-40 SPAC806.03c |rps2601|rps26-1, rps26|40S ribosomal protein S26|Sc... 154 5e-39 SPCC126.15c |sec65||signal recognition particle subunit Sec65 |S... 29 0.39 SPCC553.04 |cyp9||WD repeat containing cyclophilin family peptid... 25 3.7 SPBC1289.07c |rpc40|rpa42|DNA-directed RNA polymerase I and III ... 25 3.7 SPBC27B12.12c |||CorA family magnesium ion transporter |Schizosa... 25 4.8 >SPAC1805.11c |rps2602|rps26-2|40S ribosomal protein S26|Schizosaccharomyces pombe|chr 1|||Manual Length = 119 Score = 159 bits (386), Expect = 2e-40 Identities = 75/117 (64%), Positives = 93/117 (79%), Gaps = 3/117 (2%) Frame = +2 Query: 29 MTRKRRNGGRAKHGRGHVKAVRCTNCARCVPKDKAIKKFVIRNIVEAAAVRDINDASVYP 208 MT+KRRN GR KHGRGHVK VRC NC+R VPKDKAIK++ IRN+VE AA+RD+++ASVY Sbjct: 1 MTQKRRNNGRNKHGRGHVKFVRCINCSRAVPKDKAIKRWTIRNMVETAAIRDLSEASVYS 60 Query: 209 MFQLPKLYAKLHYCVSCAIHSKVVRNRSKKDRRIRT-PPKSNFPRDMSR--PQAVQR 370 + +PKLY KL YCVSCAIHS+VVR RS++ RRIRT PP+ + RD + P AV + Sbjct: 61 EYTIPKLYIKLQYCVSCAIHSRVVRVRSREGRRIRTPPPRVRYNRDGKKVNPTAVAK 117 >SPAC806.03c |rps2601|rps26-1, rps26|40S ribosomal protein S26|Schizosaccharomyces pombe|chr 1|||Manual Length = 120 Score = 154 bits (374), Expect = 5e-39 Identities = 72/117 (61%), Positives = 92/117 (78%), Gaps = 3/117 (2%) Frame = +2 Query: 29 MTRKRRNGGRAKHGRGHVKAVRCTNCARCVPKDKAIKKFVIRNIVEAAAVRDINDASVYP 208 MT+KRRN GR KHGRGH K VRC NC+R VPKDKAIK++ IRN+VE AA+RD+++ASVY Sbjct: 1 MTQKRRNCGRNKHGRGHTKFVRCINCSRAVPKDKAIKRWNIRNMVETAAIRDLSEASVYS 60 Query: 209 MFQLPKLYAKLHYCVSCAIHSKVVRNRSKKDRRIRT-PPKSNFPRDMSR--PQAVQR 370 + +PK+Y KL YCVSCAIH++VVR RS++ RRIRT PP+ + RD R P A+ + Sbjct: 61 EYAIPKIYVKLQYCVSCAIHARVVRVRSREGRRIRTPPPRVRYNRDGKRVNPAAIAK 117 >SPCC126.15c |sec65||signal recognition particle subunit Sec65 |Schizosaccharomyces pombe|chr 3|||Manual Length = 199 Score = 28.7 bits (61), Expect = 0.39 Identities = 15/26 (57%), Positives = 18/26 (69%) Frame = +2 Query: 110 RCVPKDKAIKKFVIRNIVEAAAVRDI 187 RCVPKDKAI + +NI A VRD+ Sbjct: 20 RCVPKDKAILNPLAKNI--ADVVRDL 43 >SPCC553.04 |cyp9||WD repeat containing cyclophilin family peptidyl-prolyl cis-trans isomerase Cyp9|Schizosaccharomyces pombe|chr 3|||Manual Length = 610 Score = 25.4 bits (53), Expect = 3.7 Identities = 11/40 (27%), Positives = 24/40 (60%) Frame = -2 Query: 169 RFYDVPNHELFDGLVLWHAPRAVCASHGFNVTTSMLGASS 50 + +DV + +L + + L P+A+C + ++ TS++ SS Sbjct: 115 KVFDVESIDLVNIIDLEFLPKAICCFNSPSLKTSLIAVSS 154 >SPBC1289.07c |rpc40|rpa42|DNA-directed RNA polymerase I and III subunit Rpc40 |Schizosaccharomyces pombe|chr 2|||Manual Length = 348 Score = 25.4 bits (53), Expect = 3.7 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = +3 Query: 276 LSGTDRRKTEESVLLPRVTSLGT 344 ++ DR +TE SVL RVT +G+ Sbjct: 1 MAAVDRSRTEISVLSDRVTDVGS 23 >SPBC27B12.12c |||CorA family magnesium ion transporter |Schizosaccharomyces pombe|chr 2|||Manual Length = 803 Score = 25.0 bits (52), Expect = 4.8 Identities = 10/27 (37%), Positives = 15/27 (55%) Frame = +2 Query: 248 CVSCAIHSKVVRNRSKKDRRIRTPPKS 328 C SC+ K N+ + RR++ PKS Sbjct: 142 CGSCSDSKKPQSNKKHRGRRVKHSPKS 168 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,410,549 Number of Sequences: 5004 Number of extensions: 23956 Number of successful extensions: 57 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 56 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 57 length of database: 2,362,478 effective HSP length: 66 effective length of database: 2,032,214 effective search space used: 150383836 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -