BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0472 (750 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF080430-1|AAC28863.2| 208|Apis mellifera ribosomal protein S8 ... 22 5.3 AY526236-1|AAS20469.1| 85|Apis mellifera epoxide hydrolase pro... 21 9.3 >AF080430-1|AAC28863.2| 208|Apis mellifera ribosomal protein S8 protein. Length = 208 Score = 22.2 bits (45), Expect = 5.3 Identities = 10/28 (35%), Positives = 13/28 (46%) Frame = +3 Query: 498 GNPIANQHIGPVFTYGTRRELGNXAFSA 581 G P AN +GP + R GN + A Sbjct: 30 GRPAANTKLGPQRIHTVRTRGGNKKYRA 57 >AY526236-1|AAS20469.1| 85|Apis mellifera epoxide hydrolase protein. Length = 85 Score = 21.4 bits (43), Expect = 9.3 Identities = 11/33 (33%), Positives = 16/33 (48%) Frame = +3 Query: 375 NWKTNLRCTVKXFLCSNGYKPXXXDAQEHYAKW 473 N T+L + +L Y P A EHY+K+ Sbjct: 27 NMCTSLNLSNLFWLFVGTYFPSLIGANEHYSKF 59 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 175,125 Number of Sequences: 438 Number of extensions: 2992 Number of successful extensions: 15 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23510295 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -