BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0471 (750 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC1921.05 |ape2||aminopeptidase Ape2|Schizosaccharomyces pombe... 38 0.001 SPBC337.12 |||human ZC3H3 homolog|Schizosaccharomyces pombe|chr ... 26 5.0 SPCC70.10 |||sequence orphan|Schizosaccharomyces pombe|chr 3|||M... 26 6.6 SPAC1851.04c ||SPAC27D7.01c|guanyl-nucleotide exchange factor |S... 26 6.6 SPAPB1A11.03 |||FMN dependent dehydrogenase|Schizosaccharomyces ... 25 8.7 >SPBC1921.05 |ape2||aminopeptidase Ape2|Schizosaccharomyces pombe|chr 2|||Manual Length = 882 Score = 38.3 bits (85), Expect = 0.001 Identities = 32/109 (29%), Positives = 50/109 (45%), Gaps = 5/109 (4%) Frame = +2 Query: 188 LEKIVEPTGYKLDLXPFLDDGVYRGTVKIQLKWLQESDELSLHCDHELGISF---WDVQA 358 L K V+P Y L L P L+ Y G V + L L++S+ ++LH + ++ W Q Sbjct: 20 LPKNVKPIHYDLSLYPDLETFTYGGKVVVTLDVLEDSNSITLHGINLRILTAALEWGSQT 79 Query: 359 YPASDAEHPVXRVVVK--ELRMDVKKPILTLYFEKPIPKGTEGHIXLTY 499 AS+ + R+V++ +LTL F I G EG +Y Sbjct: 80 VWASEVSYGDERIVLQFPSTVPANSVAVLTLPFTARISSGMEGFYRSSY 128 >SPBC337.12 |||human ZC3H3 homolog|Schizosaccharomyces pombe|chr 2|||Manual Length = 377 Score = 26.2 bits (55), Expect = 5.0 Identities = 14/33 (42%), Positives = 16/33 (48%) Frame = +1 Query: 415 YGRQKADIDFVFRKADPQGNRRSYXVDVSRQYS 513 Y +KA+ V A N RSY VSR YS Sbjct: 20 YKNEKAEPTQVLDAAKANKNTRSYPYSVSRNYS 52 >SPCC70.10 |||sequence orphan|Schizosaccharomyces pombe|chr 3|||Manual Length = 155 Score = 25.8 bits (54), Expect = 6.6 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = -2 Query: 248 RRRGTAXSPAYIQSAPRSSPNGFP*RAHMRY 156 RR T+ AY+ + +SP G P R +RY Sbjct: 59 RRSPTSPQSAYVPATVYTSPIGSPRRGSVRY 89 >SPAC1851.04c ||SPAC27D7.01c|guanyl-nucleotide exchange factor |Schizosaccharomyces pombe|chr 1|||Manual Length = 1052 Score = 25.8 bits (54), Expect = 6.6 Identities = 13/44 (29%), Positives = 21/44 (47%), Gaps = 2/44 (4%) Frame = +2 Query: 284 WLQESDELSLHCDHELGISFWDVQAYPAS--DAEHPVXRVVVKE 409 ++ +S E + GI FWD YP +E P+ V +K+ Sbjct: 463 YISKSYEFCSSVKNNFGIDFWDQVEYPQPYVASEWPIRYVSIKD 506 >SPAPB1A11.03 |||FMN dependent dehydrogenase|Schizosaccharomyces pombe|chr 1|||Manual Length = 407 Score = 25.4 bits (53), Expect = 8.7 Identities = 15/32 (46%), Positives = 18/32 (56%) Frame = +2 Query: 167 GLAMETRLEKIVEPTGYKLDLXPFLDDGVYRG 262 G+A T L KIV+ G KLD+ D GV G Sbjct: 309 GVASLTMLPKIVDAVGDKLDV--LFDSGVRSG 338 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,509,917 Number of Sequences: 5004 Number of extensions: 44344 Number of successful extensions: 120 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 120 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 120 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 357280532 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -