BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0468 (750 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methylt... 23 3.1 AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 21 9.3 >AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methyltransferase protein. Length = 683 Score = 23.0 bits (47), Expect = 3.1 Identities = 10/41 (24%), Positives = 21/41 (51%) Frame = +1 Query: 268 VTYLMEKKKVNGPYLIIVPLSTLSNWVLEFEKWAPTVSVVS 390 V ++ KK++ G + L NW L++ W P ++++ Sbjct: 246 VEQILAKKEIKG---VPTYLIKWKNWDLKYNTWEPISNLIN 283 Score = 22.2 bits (45), Expect = 5.3 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = +3 Query: 267 GHLPHGKEESEWTLSNYRTVEYSFKL 344 GH+ HGK +S +TV + +L Sbjct: 49 GHVAHGKSTIVKAISGVQTVRFKNEL 74 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 21.4 bits (43), Expect = 9.3 Identities = 10/37 (27%), Positives = 17/37 (45%) Frame = +1 Query: 10 EYKARDMIKKAKVEDDEYKTEEQTYYSIAHTVHESVT 120 ++KA ++ A+ YK E+T S T + T Sbjct: 281 QHKAMFLVVTAQPVHSAYKAPEETIISSVFTTRHNAT 317 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.317 0.133 0.395 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 216,124 Number of Sequences: 438 Number of extensions: 4537 Number of successful extensions: 12 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23510295 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -