BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0464 (750 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ383819-1|ABD38144.1| 377|Anopheles gambiae abdominal-B protein. 27 0.47 AF395079-1|AAK97461.1| 371|Anopheles gambiae basic helix-loop-h... 26 1.4 AF444780-1|AAL37901.1| 1152|Anopheles gambiae Toll protein. 24 5.8 >DQ383819-1|ABD38144.1| 377|Anopheles gambiae abdominal-B protein. Length = 377 Score = 27.5 bits (58), Expect = 0.47 Identities = 13/53 (24%), Positives = 27/53 (50%), Gaps = 2/53 (3%) Frame = +1 Query: 361 PSEETARPSPYAQHHPPQITLHTRTQKSNGTRKTKPT*QAVV--LNATXVKTY 513 P+E +P PY + P + T++S G +P+ Q+ N++ +++Y Sbjct: 182 PTEANFQPHPYYPKYEPDAYITASTERSRGVTGDQPSLQSSYESYNSSGLRSY 234 >AF395079-1|AAK97461.1| 371|Anopheles gambiae basic helix-loop-helix transcriptionfactor ASH protein. Length = 371 Score = 25.8 bits (54), Expect = 1.4 Identities = 9/27 (33%), Positives = 19/27 (70%) Frame = +2 Query: 209 NRKISKLEVIQHVIDYICDLQSALENH 289 N+K+SK++ ++ ++YI LQ L+ + Sbjct: 144 NKKLSKVDTLRLAVEYIRSLQRMLDEN 170 >AF444780-1|AAL37901.1| 1152|Anopheles gambiae Toll protein. Length = 1152 Score = 23.8 bits (49), Expect = 5.8 Identities = 16/58 (27%), Positives = 27/58 (46%), Gaps = 2/58 (3%) Frame = -2 Query: 563 PWQRWPLRGIFININHK*VLT*VAFNTTACQVGFVFLVPFDFC--VRVWRVICGGWCW 396 P ++ L + ++ H VLT V + AC V + LV + + ++VW G W Sbjct: 827 PLEQMTLSDLCVDRTHMIVLTCVIVSVVACLVAALSLVYYTYKLELKVWLFKHGLCLW 884 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 731,251 Number of Sequences: 2352 Number of extensions: 13730 Number of successful extensions: 19 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 77339358 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -