BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0463 (700 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_05_0059 + 22011168-22011662,22012668-22012894,22013029-220133... 29 3.5 08_02_0841 - 21749599-21749978,21750409-21753367 28 8.2 >05_05_0059 + 22011168-22011662,22012668-22012894,22013029-22013377, 22013464-22013508,22013589-22013735,22013851-22013988, 22014126-22014159,22014258-22014430 Length = 535 Score = 29.1 bits (62), Expect = 3.5 Identities = 17/46 (36%), Positives = 24/46 (52%), Gaps = 1/46 (2%) Frame = +3 Query: 9 LRXLWLGLWS-NVSLYRFVSSTVSTQPLPSLKSGRQATKLVLSEHP 143 L LWL +W NV S T+S L + +GR A+K+ S+ P Sbjct: 289 LGYLWLSVWLFNVESDPLDSRTISKSELQLILAGRSASKIQGSKFP 334 >08_02_0841 - 21749599-21749978,21750409-21753367 Length = 1112 Score = 27.9 bits (59), Expect = 8.2 Identities = 15/40 (37%), Positives = 25/40 (62%) Frame = +3 Query: 21 WLGLWSNVSLYRFVSSTVSTQPLPSLKSGRQATKLVLSEH 140 WLG S+++ FV++ +S Q SL R ++L+LSE+ Sbjct: 276 WLGNCSSLTQLAFVNNNISGQIPSSLGLLRNLSQLLLSEN 315 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,987,025 Number of Sequences: 37544 Number of extensions: 309988 Number of successful extensions: 491 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 486 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 491 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1792053856 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -