BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0463 (700 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC130432-1|AAI30433.1| 612|Homo sapiens otopetrin 1 protein. 31 4.0 BC130430-1|AAI30431.1| 612|Homo sapiens otopetrin 1 protein. 31 4.0 >BC130432-1|AAI30433.1| 612|Homo sapiens otopetrin 1 protein. Length = 612 Score = 31.1 bits (67), Expect = 4.0 Identities = 11/30 (36%), Positives = 18/30 (60%) Frame = +2 Query: 17 FVAWSLVQRFTLPLCIFHRFHSAVTLAEIW 106 F W +V +P IF+R H+A +L E++ Sbjct: 580 FEPWIIVVNLAMPFSIFYRMHAAASLFEVY 609 >BC130430-1|AAI30431.1| 612|Homo sapiens otopetrin 1 protein. Length = 612 Score = 31.1 bits (67), Expect = 4.0 Identities = 11/30 (36%), Positives = 18/30 (60%) Frame = +2 Query: 17 FVAWSLVQRFTLPLCIFHRFHSAVTLAEIW 106 F W +V +P IF+R H+A +L E++ Sbjct: 580 FEPWIIVVNLAMPFSIFYRMHAAASLFEVY 609 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 94,940,641 Number of Sequences: 237096 Number of extensions: 1756917 Number of successful extensions: 2655 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2585 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2655 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 8063224416 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -