BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0461 (519 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_01_0363 + 4754650-4755912 31 0.55 02_05_1260 + 35299795-35299905,35300065-35300112,35301181-35302356 28 3.9 06_03_0774 + 24504964-24507459 27 6.8 04_01_0031 + 381389-381841 27 6.8 02_03_0303 - 17506392-17506399,17507055-17507286,17507390-175074... 27 9.0 >04_01_0363 + 4754650-4755912 Length = 420 Score = 31.1 bits (67), Expect = 0.55 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +1 Query: 31 TSPARGAPCRLANEALAETHWNRRTGHR 114 T+ A GAP A E E W RRTG+R Sbjct: 95 TAAADGAPAATATEGDGERGWRRRTGNR 122 >02_05_1260 + 35299795-35299905,35300065-35300112,35301181-35302356 Length = 444 Score = 28.3 bits (60), Expect = 3.9 Identities = 16/40 (40%), Positives = 23/40 (57%) Frame = -1 Query: 402 SKNNY*DQLDFNQIYST*IIITLVFNPNENINGTCNPFPE 283 SKN +L QIY I L+ +P+ +GTC+PFP+ Sbjct: 211 SKNAETGELQSYQIYPESPIGRLI-SPSSACSGTCSPFPD 249 >06_03_0774 + 24504964-24507459 Length = 831 Score = 27.5 bits (58), Expect = 6.8 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +3 Query: 33 LSCTRCTLPISERGSGGD 86 + C RC P++ RG GGD Sbjct: 712 ICCRRCQDPVTSRGEGGD 729 >04_01_0031 + 381389-381841 Length = 150 Score = 27.5 bits (58), Expect = 6.8 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = +1 Query: 13 PIEPKPTSPARGAPCRLANEALAETHWNRRTG 108 P+EP P++P A E + W RR+G Sbjct: 98 PLEPAPSAPEMAAAAAEEEEEESRHAWRRRSG 129 >02_03_0303 - 17506392-17506399,17507055-17507286,17507390-17507461, 17507561-17508586,17509194-17509448,17510483-17510962 Length = 690 Score = 27.1 bits (57), Expect = 9.0 Identities = 13/29 (44%), Positives = 17/29 (58%) Frame = -3 Query: 112 GDRYDGSSASPPEPRSLIGRVHRVQERLA 26 G R + SSA PP PRS + R ++E A Sbjct: 98 GSRGESSSAPPPPPRSRVLRQGGLEEEYA 126 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,670,363 Number of Sequences: 37544 Number of extensions: 202520 Number of successful extensions: 459 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 453 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 459 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1130733700 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -