BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0460 (700 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U39676-5|AAN60531.1| 2329|Caenorhabditis elegans Hypothetical pr... 30 1.8 U39676-4|AAN60532.1| 2747|Caenorhabditis elegans Hypothetical pr... 30 1.8 >U39676-5|AAN60531.1| 2329|Caenorhabditis elegans Hypothetical protein C23F12.1a protein. Length = 2329 Score = 29.9 bits (64), Expect = 1.8 Identities = 24/69 (34%), Positives = 34/69 (49%) Frame = +1 Query: 91 RSGGSPTQLGHGRPRKQLSFLLCESLLKKSRCCQTYGGSQHSKSFSGPRQPAWAGSGPSP 270 RS SPT L H R R + + L LL++SR S ++ S S + A++ S P Sbjct: 250 RSPTSPTLLQHARQRSEETMLRSPQLLRESRKADKPWQSSYAPSSS---RNAFSQS-PHR 305 Query: 271 CWSRARVLD 297 WS + V D Sbjct: 306 DWSASTVYD 314 >U39676-4|AAN60532.1| 2747|Caenorhabditis elegans Hypothetical protein C23F12.1b protein. Length = 2747 Score = 29.9 bits (64), Expect = 1.8 Identities = 24/69 (34%), Positives = 34/69 (49%) Frame = +1 Query: 91 RSGGSPTQLGHGRPRKQLSFLLCESLLKKSRCCQTYGGSQHSKSFSGPRQPAWAGSGPSP 270 RS SPT L H R R + + L LL++SR S ++ S S + A++ S P Sbjct: 250 RSPTSPTLLQHARQRSEETMLRSPQLLRESRKADKPWQSSYAPSSS---RNAFSQS-PHR 305 Query: 271 CWSRARVLD 297 WS + V D Sbjct: 306 DWSASTVYD 314 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,377,956 Number of Sequences: 27780 Number of extensions: 319614 Number of successful extensions: 786 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 762 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 786 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1613473434 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -