BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0457 (700 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_28157| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_13395| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_49600| Best HMM Match : RVT_1 (HMM E-Value=0) 50 2e-06 SB_26135| Best HMM Match : RVT_1 (HMM E-Value=0.072) 50 2e-06 SB_19328| Best HMM Match : RVT_1 (HMM E-Value=2e-36) 50 2e-06 SB_2897| Best HMM Match : RVT_1 (HMM E-Value=3e-33) 50 2e-06 SB_1793| Best HMM Match : RVT_1 (HMM E-Value=0) 50 2e-06 SB_43541| Best HMM Match : RVT_1 (HMM E-Value=0) 50 2e-06 SB_41552| Best HMM Match : RVT_1 (HMM E-Value=5.4e-32) 50 2e-06 SB_20131| Best HMM Match : RVT_1 (HMM E-Value=0.0049) 50 2e-06 SB_20120| Best HMM Match : RVT_1 (HMM E-Value=0) 50 2e-06 SB_18871| Best HMM Match : RVT_1 (HMM E-Value=0) 50 2e-06 SB_56449| Best HMM Match : RVT_1 (HMM E-Value=0.28) 49 4e-06 SB_32446| Best HMM Match : RVT_1 (HMM E-Value=0.04) 49 4e-06 SB_32070| Best HMM Match : RVT_1 (HMM E-Value=2.4e-15) 49 4e-06 SB_2746| Best HMM Match : RVT_1 (HMM E-Value=1.10002e-42) 49 4e-06 SB_2102| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 4e-06 SB_55880| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 4e-06 SB_29272| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 4e-06 SB_10927| Best HMM Match : RVT_1 (HMM E-Value=6.6e-39) 49 4e-06 SB_5114| Best HMM Match : RVT_1 (HMM E-Value=1.10002e-42) 49 4e-06 SB_41513| Best HMM Match : RVT_1 (HMM E-Value=8.9e-21) 48 6e-06 SB_30812| Best HMM Match : RVT_1 (HMM E-Value=1.2e-40) 48 6e-06 SB_30053| Best HMM Match : RVT_1 (HMM E-Value=2.3e-24) 48 6e-06 SB_27128| Best HMM Match : PADR1 (HMM E-Value=8.3) 48 6e-06 SB_11753| Best HMM Match : RVT_1 (HMM E-Value=0) 48 6e-06 SB_9212| Best HMM Match : RVT_1 (HMM E-Value=4.5e-36) 48 6e-06 SB_7615| Best HMM Match : RVT_1 (HMM E-Value=1e-33) 48 6e-06 SB_5465| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 6e-06 SB_24534| Best HMM Match : RVT_1 (HMM E-Value=0) 48 6e-06 SB_1851| Best HMM Match : RVT_1 (HMM E-Value=3.2e-16) 48 6e-06 SB_58595| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_57671| Best HMM Match : RVT_1 (HMM E-Value=0) 48 7e-06 SB_53367| Best HMM Match : RVT_1 (HMM E-Value=0) 48 7e-06 SB_6954| Best HMM Match : RVT_1 (HMM E-Value=0) 48 7e-06 SB_50273| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_35779| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_30833| Best HMM Match : RVT_1 (HMM E-Value=3.50044e-42) 48 7e-06 SB_17278| Best HMM Match : RVT_1 (HMM E-Value=0.0082) 48 7e-06 SB_11838| Best HMM Match : RVT_1 (HMM E-Value=0) 48 7e-06 SB_51334| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_31162| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_47691| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_35764| Best HMM Match : RVT_1 (HMM E-Value=8.1e-13) 47 1e-05 SB_33398| Best HMM Match : Sorb (HMM E-Value=9.9) 47 1e-05 SB_27893| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_14910| Best HMM Match : RVT_1 (HMM E-Value=0.47) 47 2e-05 SB_22738| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_40804| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 2e-05 SB_37835| Best HMM Match : RVT_1 (HMM E-Value=0) 46 2e-05 SB_46139| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_25338| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_24803| Best HMM Match : LRR_1 (HMM E-Value=0.0066) 46 3e-05 SB_18966| Best HMM Match : RVT_1 (HMM E-Value=0.028) 46 3e-05 SB_12308| Best HMM Match : RVT_1 (HMM E-Value=0) 46 3e-05 SB_576| Best HMM Match : RVT_1 (HMM E-Value=0) 46 3e-05 SB_52166| Best HMM Match : Exo_endo_phos (HMM E-Value=5.6e-10) 46 3e-05 SB_49562| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_42505| Best HMM Match : RVT_1 (HMM E-Value=3.9e-18) 46 3e-05 SB_40344| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_25064| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_23493| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_18909| Best HMM Match : RVT_1 (HMM E-Value=1.2e-28) 46 3e-05 SB_12008| Best HMM Match : RVT_1 (HMM E-Value=0) 46 3e-05 SB_10154| Best HMM Match : RVT_1 (HMM E-Value=4.3e-17) 46 3e-05 SB_6960| Best HMM Match : RVT_1 (HMM E-Value=1.6e-21) 46 3e-05 SB_45791| Best HMM Match : Ribosomal_L30_N (HMM E-Value=0.2) 46 4e-05 SB_42669| Best HMM Match : Sorb (HMM E-Value=9.2) 46 4e-05 SB_33087| Best HMM Match : Fascin (HMM E-Value=8.9) 46 4e-05 SB_30852| Best HMM Match : RVT_1 (HMM E-Value=0) 46 4e-05 SB_26585| Best HMM Match : RVT_1 (HMM E-Value=0) 46 4e-05 SB_13686| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_6247| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_42310| Best HMM Match : RVT_1 (HMM E-Value=0) 46 4e-05 SB_31875| Best HMM Match : SNF2_N (HMM E-Value=0) 46 4e-05 SB_29864| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_14288| Best HMM Match : Sorb (HMM E-Value=9.9) 46 4e-05 SB_63| Best HMM Match : RVT_1 (HMM E-Value=0) 46 4e-05 SB_59792| Best HMM Match : RVT_1 (HMM E-Value=4.2039e-45) 45 5e-05 SB_51388| Best HMM Match : RVT_1 (HMM E-Value=0) 45 5e-05 SB_42960| Best HMM Match : RVT_1 (HMM E-Value=2.38221e-44) 45 5e-05 SB_35551| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 5e-05 SB_33817| Best HMM Match : RVT_1 (HMM E-Value=0.1) 45 5e-05 SB_31168| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 5e-05 SB_30009| Best HMM Match : RVT_1 (HMM E-Value=1.2e-18) 45 5e-05 SB_27537| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 5e-05 SB_17181| Best HMM Match : RVT_1 (HMM E-Value=0) 45 5e-05 SB_11072| Best HMM Match : SH2 (HMM E-Value=6.4) 45 5e-05 SB_9950| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 5e-05 SB_7414| Best HMM Match : SH2 (HMM E-Value=6.4) 45 5e-05 SB_7292| Best HMM Match : RVT_1 (HMM E-Value=0) 45 5e-05 SB_3142| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 5e-05 SB_2227| Best HMM Match : RVT_1 (HMM E-Value=0.1) 45 5e-05 SB_58023| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 5e-05 SB_48125| Best HMM Match : RVT_1 (HMM E-Value=8.4e-38) 45 5e-05 SB_45340| Best HMM Match : RVT_1 (HMM E-Value=1.2e-15) 45 5e-05 SB_45005| Best HMM Match : RVT_1 (HMM E-Value=6.6e-32) 45 5e-05 SB_39667| Best HMM Match : rve (HMM E-Value=9e-32) 45 5e-05 SB_39321| Best HMM Match : RVT_1 (HMM E-Value=4.5e-39) 45 5e-05 SB_38334| Best HMM Match : RVT_1 (HMM E-Value=5.60519e-45) 45 5e-05 SB_33045| Best HMM Match : RVT_1 (HMM E-Value=3.4e-18) 45 5e-05 SB_27764| Best HMM Match : RVT_1 (HMM E-Value=3.99931e-42) 45 5e-05 SB_25508| Best HMM Match : RVT_1 (HMM E-Value=6e-14) 45 5e-05 SB_25299| Best HMM Match : RVT_1 (HMM E-Value=1.1e-23) 45 5e-05 SB_24847| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 5e-05 SB_24694| Best HMM Match : RVT_1 (HMM E-Value=0.99) 45 5e-05 SB_39712| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_35875| Best HMM Match : RVT_1 (HMM E-Value=5.2e-24) 45 7e-05 SB_35814| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_1758| Best HMM Match : RVT_1 (HMM E-Value=0) 45 7e-05 SB_53026| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_35523| Best HMM Match : RVT_1 (HMM E-Value=0) 45 7e-05 SB_28024| Best HMM Match : RVT_1 (HMM E-Value=0) 45 7e-05 SB_20293| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_20057| Best HMM Match : RVT_1 (HMM E-Value=3e-13) 45 7e-05 SB_42093| Best HMM Match : RVT_1 (HMM E-Value=2.5e-20) 44 9e-05 SB_40417| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_33952| Best HMM Match : Lectin_C (HMM E-Value=3.1) 44 9e-05 SB_32252| Best HMM Match : RVT_1 (HMM E-Value=9.2e-21) 44 9e-05 SB_28572| Best HMM Match : RVT_1 (HMM E-Value=2e-20) 44 9e-05 SB_26303| Best HMM Match : Fascin (HMM E-Value=4.4) 44 9e-05 SB_19870| Best HMM Match : RVT_1 (HMM E-Value=0.18) 44 9e-05 SB_15993| Best HMM Match : RVT_1 (HMM E-Value=7.2e-12) 44 9e-05 SB_3473| Best HMM Match : Fascin (HMM E-Value=4.4) 44 9e-05 SB_54752| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_43973| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_35242| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_24162| Best HMM Match : RVT_1 (HMM E-Value=0) 44 9e-05 SB_11864| Best HMM Match : RVT_1 (HMM E-Value=0.012) 44 9e-05 SB_11516| Best HMM Match : Lectin_C (HMM E-Value=2.9) 44 9e-05 SB_11213| Best HMM Match : RVT_1 (HMM E-Value=6.4e-38) 44 9e-05 SB_10781| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_10495| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_3017| Best HMM Match : RVT_1 (HMM E-Value=1.1e-19) 44 9e-05 SB_57037| Best HMM Match : RVT_1 (HMM E-Value=3.4e-15) 44 1e-04 SB_56220| Best HMM Match : RVT_1 (HMM E-Value=3.7e-16) 44 1e-04 SB_47621| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_34116| Best HMM Match : RVT_1 (HMM E-Value=0) 44 1e-04 SB_30332| Best HMM Match : RVT_1 (HMM E-Value=2.7e-34) 44 1e-04 SB_28979| Best HMM Match : RVT_1 (HMM E-Value=1.6e-40) 44 1e-04 SB_59500| Best HMM Match : RVT_1 (HMM E-Value=0.015) 44 1e-04 SB_54400| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_50676| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_28404| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_25497| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_21992| Best HMM Match : LRR_1 (HMM E-Value=3.2e-07) 44 1e-04 SB_11067| Best HMM Match : RVT_1 (HMM E-Value=0) 44 1e-04 SB_7440| Best HMM Match : fn3 (HMM E-Value=0.35) 44 1e-04 SB_5024| Best HMM Match : rve (HMM E-Value=6.3e-36) 44 1e-04 SB_2458| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_53252| Best HMM Match : RVT_1 (HMM E-Value=0) 44 2e-04 SB_49549| Best HMM Match : RVT_1 (HMM E-Value=3.6e-11) 44 2e-04 SB_32197| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_19117| Best HMM Match : XPG_N (HMM E-Value=1.8) 44 2e-04 SB_53855| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_52988| Best HMM Match : RVT_1 (HMM E-Value=2.5) 44 2e-04 SB_37732| Best HMM Match : RVT_1 (HMM E-Value=2e-23) 44 2e-04 SB_36813| Best HMM Match : RVT_1 (HMM E-Value=1.4e-14) 44 2e-04 SB_33259| Best HMM Match : RVT_1 (HMM E-Value=4.3e-12) 44 2e-04 SB_24072| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_19684| Best HMM Match : RVT_1 (HMM E-Value=0) 44 2e-04 SB_5957| Best HMM Match : Chitin_synth_1 (HMM E-Value=9) 44 2e-04 SB_39979| Best HMM Match : RVT_1 (HMM E-Value=4.6e-12) 43 2e-04 SB_39386| Best HMM Match : RVT_1 (HMM E-Value=7.1e-28) 43 2e-04 SB_31085| Best HMM Match : RVT_1 (HMM E-Value=0.0094) 43 2e-04 SB_27867| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_907| Best HMM Match : RVT_1 (HMM E-Value=1.3e-27) 43 2e-04 SB_798| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_30760| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_14841| Best HMM Match : RVT_1 (HMM E-Value=0) 43 2e-04 SB_58923| Best HMM Match : RVT_1 (HMM E-Value=0.022) 43 3e-04 SB_58171| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_40620| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_39669| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_37487| Best HMM Match : RVT_1 (HMM E-Value=0.03) 43 3e-04 SB_36088| Best HMM Match : RVT_1 (HMM E-Value=9e-12) 43 3e-04 SB_33669| Best HMM Match : EMP70 (HMM E-Value=3.9e-11) 43 3e-04 SB_27524| Best HMM Match : RVT_1 (HMM E-Value=1.30321e-43) 43 3e-04 SB_24260| Best HMM Match : Rotavirus_VP7 (HMM E-Value=7.7) 43 3e-04 SB_21609| Best HMM Match : Peptidase_M23 (HMM E-Value=5.7) 43 3e-04 SB_18646| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_17950| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_7633| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_53800| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_51996| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_41541| Best HMM Match : RVT_1 (HMM E-Value=3.1e-17) 43 3e-04 SB_41403| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_41175| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_38851| Best HMM Match : RVT_1 (HMM E-Value=9.8e-20) 43 3e-04 SB_36163| Best HMM Match : RVT_1 (HMM E-Value=4.2e-11) 43 3e-04 SB_32204| Best HMM Match : wnt (HMM E-Value=8.2e-31) 43 3e-04 SB_30215| Best HMM Match : RVT_1 (HMM E-Value=2.6e-34) 43 3e-04 SB_27268| Best HMM Match : RVT_1 (HMM E-Value=2.24208e-44) 43 3e-04 SB_23276| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_14371| Best HMM Match : RVT_1 (HMM E-Value=2.2e-18) 43 3e-04 SB_7760| Best HMM Match : Peptidase_M23 (HMM E-Value=5.7) 43 3e-04 SB_7055| Best HMM Match : RVT_1 (HMM E-Value=0.00051) 43 3e-04 SB_2851| Best HMM Match : RVT_1 (HMM E-Value=3.50325e-43) 43 3e-04 SB_26221| Best HMM Match : RVT_1 (HMM E-Value=1.6e-24) 42 4e-04 SB_8605| Best HMM Match : RVT_1 (HMM E-Value=0) 42 4e-04 SB_3943| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_40881| Best HMM Match : RVT_1 (HMM E-Value=2.9e-21) 42 5e-04 SB_31876| Best HMM Match : RVT_1 (HMM E-Value=0) 42 5e-04 SB_54068| Best HMM Match : RVT_1 (HMM E-Value=0.92) 42 5e-04 SB_51232| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_47851| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_19795| Best HMM Match : RVT_1 (HMM E-Value=1.3) 42 5e-04 SB_6463| Best HMM Match : RVT_1 (HMM E-Value=2.2e-13) 42 5e-04 SB_25119| Best HMM Match : Ribosomal_S27 (HMM E-Value=9.4) 42 6e-04 SB_20001| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_17732| Best HMM Match : RVT_1 (HMM E-Value=1.5e-27) 42 6e-04 SB_12291| Best HMM Match : Exo_endo_phos (HMM E-Value=1.8e-09) 41 8e-04 SB_10379| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 8e-04 SB_5816| Best HMM Match : RVT_1 (HMM E-Value=3e-16) 41 8e-04 SB_58989| Best HMM Match : RVT_1 (HMM E-Value=0) 41 8e-04 SB_38372| Best HMM Match : RVT_1 (HMM E-Value=0) 41 8e-04 SB_30161| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 8e-04 SB_43617| Best HMM Match : RVT_1 (HMM E-Value=3e-21) 41 0.001 SB_35376| Best HMM Match : RVT_1 (HMM E-Value=0) 41 0.001 SB_21844| Best HMM Match : RVT_1 (HMM E-Value=0) 41 0.001 SB_56177| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_52464| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_42891| Best HMM Match : DUF537 (HMM E-Value=1.2e-23) 41 0.001 SB_38806| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_36891| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_30407| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_28762| Best HMM Match : RVT_1 (HMM E-Value=3.9e-23) 41 0.001 SB_19106| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_12274| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_11572| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_7145| Best HMM Match : RVT_1 (HMM E-Value=3.8e-25) 41 0.001 SB_59383| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_35480| Best HMM Match : RVT_1 (HMM E-Value=0.0085) 40 0.001 SB_32837| Best HMM Match : RVT_1 (HMM E-Value=8.3e-17) 40 0.001 SB_27763| Best HMM Match : VapD_N (HMM E-Value=10) 40 0.001 SB_24816| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_52616| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_34368| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_26483| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_22732| Best HMM Match : RVT_1 (HMM E-Value=2.2e-23) 40 0.001 SB_11382| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_10718| Best HMM Match : RVT_1 (HMM E-Value=2.3e-33) 40 0.001 SB_10516| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_10251| Best HMM Match : RVT_1 (HMM E-Value=0.0022) 40 0.001 SB_18451| Best HMM Match : Sorb (HMM E-Value=9.2) 40 0.002 SB_26407| Best HMM Match : UQ_con (HMM E-Value=0) 40 0.002 SB_14872| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_11746| Best HMM Match : RVT_1 (HMM E-Value=5e-31) 40 0.002 SB_9873| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_9841| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_8967| Best HMM Match : RVT_1 (HMM E-Value=7.6e-18) 40 0.002 SB_55618| Best HMM Match : RVT_1 (HMM E-Value=0.12) 39 0.003 SB_38898| Best HMM Match : RVT_1 (HMM E-Value=4.6e-21) 39 0.003 SB_32540| Best HMM Match : RVT_1 (HMM E-Value=4.6e-21) 39 0.003 SB_30213| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_22988| Best HMM Match : RVT_1 (HMM E-Value=5.70328e-43) 39 0.003 SB_21614| Best HMM Match : RVT_1 (HMM E-Value=1.10002e-41) 39 0.003 SB_1476| Best HMM Match : RVT_1 (HMM E-Value=5.49309e-43) 39 0.003 SB_34884| Best HMM Match : RVT_1 (HMM E-Value=8.1e-25) 39 0.003 SB_33122| Best HMM Match : RVT_1 (HMM E-Value=4.6e-21) 39 0.003 SB_20766| Best HMM Match : VapD_N (HMM E-Value=10) 39 0.003 SB_14729| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_14369| Best HMM Match : RVT_1 (HMM E-Value=4.6e-21) 39 0.003 SB_10116| Best HMM Match : RVT_1 (HMM E-Value=2.5e-33) 39 0.003 SB_8360| Best HMM Match : RVT_1 (HMM E-Value=3.6e-07) 39 0.003 SB_31961| Best HMM Match : EGF (HMM E-Value=0) 38 0.006 SB_27910| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.006 SB_52511| Best HMM Match : RVT_1 (HMM E-Value=0.00044) 38 0.006 SB_59519| Best HMM Match : RVT_1 (HMM E-Value=3.5e-11) 38 0.008 SB_49551| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_33430| Best HMM Match : RVT_1 (HMM E-Value=1.3e-26) 38 0.008 SB_28387| Best HMM Match : RVT_1 (HMM E-Value=0.0013) 38 0.008 SB_14797| Best HMM Match : RVT_1 (HMM E-Value=7.9e-33) 38 0.008 SB_13132| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_12730| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_11511| Best HMM Match : RVT_1 (HMM E-Value=0.79) 38 0.008 SB_42303| Best HMM Match : RVT_1 (HMM E-Value=0.00019) 38 0.008 SB_41650| Best HMM Match : RVT_1 (HMM E-Value=1.6e-06) 38 0.008 SB_38417| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_32202| Best HMM Match : RVT_1 (HMM E-Value=0.1) 38 0.008 SB_30264| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_17450| Best HMM Match : RVT_1 (HMM E-Value=2.2e-25) 38 0.008 SB_17431| Best HMM Match : RVT_1 (HMM E-Value=1.8e-25) 38 0.008 SB_8080| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_55916| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_33611| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_17448| Best HMM Match : RVT_1 (HMM E-Value=0.00044) 38 0.010 SB_47504| Best HMM Match : RVT_1 (HMM E-Value=1.4e-07) 38 0.010 SB_45120| Best HMM Match : GFP (HMM E-Value=3.3e-17) 38 0.010 SB_26424| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_6574| Best HMM Match : eIF-6 (HMM E-Value=1.60028e-42) 38 0.010 SB_51005| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.014 SB_2508| Best HMM Match : RVT_1 (HMM E-Value=1e-05) 37 0.014 SB_15624| Best HMM Match : Phage_G (HMM E-Value=9.5) 37 0.014 SB_50918| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_39089| Best HMM Match : RVT_1 (HMM E-Value=2.2e-20) 37 0.018 SB_38423| Best HMM Match : RVT_1 (HMM E-Value=7.4e-27) 37 0.018 SB_17170| Best HMM Match : RVT_1 (HMM E-Value=0.0023) 37 0.018 SB_15441| Best HMM Match : RVT_1 (HMM E-Value=1e-19) 37 0.018 SB_452| Best HMM Match : RVT_1 (HMM E-Value=9.9e-25) 37 0.018 SB_50448| Best HMM Match : RVT_1 (HMM E-Value=3.7) 37 0.018 SB_40322| Best HMM Match : RVT_1 (HMM E-Value=7.4e-27) 37 0.018 SB_23765| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_14103| Best HMM Match : RVT_1 (HMM E-Value=0.023) 37 0.018 SB_13455| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_5801| Best HMM Match : UvdE (HMM E-Value=2.2) 37 0.018 SB_54431| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_50374| Best HMM Match : OTU (HMM E-Value=0.036) 36 0.024 SB_42160| Best HMM Match : RVT_1 (HMM E-Value=0) 36 0.024 SB_40446| Best HMM Match : RVT_1 (HMM E-Value=2.2e-16) 36 0.024 SB_29435| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_22736| Best HMM Match : F5_F8_type_C (HMM E-Value=6.4e-24) 36 0.024 SB_18991| Best HMM Match : RVT_1 (HMM E-Value=2.8e-34) 36 0.024 SB_17454| Best HMM Match : Aph-1 (HMM E-Value=9.6) 36 0.024 SB_12964| Best HMM Match : RVT_1 (HMM E-Value=5.6e-31) 36 0.024 SB_8311| Best HMM Match : RVT_1 (HMM E-Value=3.9e-29) 36 0.024 SB_6749| Best HMM Match : RVT_1 (HMM E-Value=0.069) 36 0.024 SB_4338| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_2424| Best HMM Match : RVT_1 (HMM E-Value=6.2e-18) 36 0.024 SB_57531| Best HMM Match : RVT_1 (HMM E-Value=2.9e-10) 36 0.024 SB_55599| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_46946| Best HMM Match : RVT_1 (HMM E-Value=0.7) 36 0.024 SB_45694| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_44863| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_44569| Best HMM Match : Gal_Lectin (HMM E-Value=4.5) 36 0.024 SB_38694| Best HMM Match : RVT_1 (HMM E-Value=3.8e-09) 36 0.024 SB_29966| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_24491| Best HMM Match : Hormone_2 (HMM E-Value=6.4) 36 0.024 SB_21723| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_18605| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_15883| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_8907| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_2999| Best HMM Match : RVT_1 (HMM E-Value=5.6e-31) 36 0.024 SB_2489| Best HMM Match : RVT_1 (HMM E-Value=0.02) 36 0.024 SB_50200| Best HMM Match : RVT_1 (HMM E-Value=0.044) 36 0.032 SB_11322| Best HMM Match : Pkinase_C (HMM E-Value=4.1) 36 0.032 SB_8835| Best HMM Match : RVT_1 (HMM E-Value=1.2e-36) 36 0.032 SB_2303| Best HMM Match : RVT_1 (HMM E-Value=7.9e-11) 36 0.032 SB_53343| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.042 SB_50550| Best HMM Match : RVT_1 (HMM E-Value=7.5e-28) 36 0.042 SB_44245| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.042 SB_39766| Best HMM Match : RVT_1 (HMM E-Value=1.8e-07) 36 0.042 SB_39596| Best HMM Match : TTL (HMM E-Value=0) 36 0.042 SB_39529| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.042 SB_39094| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.042 SB_29231| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.042 SB_28319| Best HMM Match : zf-C2H2 (HMM E-Value=0.012) 36 0.042 SB_15983| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.042 SB_6920| Best HMM Match : RVT_1 (HMM E-Value=2.7e-06) 36 0.042 SB_3720| Best HMM Match : RVT_1 (HMM E-Value=0.0031) 36 0.042 SB_54962| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.042 SB_47528| Best HMM Match : RVT_1 (HMM E-Value=9.9e-16) 36 0.042 SB_43394| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.042 SB_31165| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.042 SB_16359| Best HMM Match : RVT_1 (HMM E-Value=0.00049) 36 0.042 SB_9990| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.042 SB_9018| Best HMM Match : NolV (HMM E-Value=2.7) 36 0.042 SB_55265| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.055 SB_51001| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.055 SB_45345| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.055 SB_39714| Best HMM Match : Lipin_N (HMM E-Value=0) 35 0.055 SB_21412| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.055 SB_18806| Best HMM Match : RVT_1 (HMM E-Value=1.7e-14) 35 0.055 SB_9383| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.055 SB_3831| Best HMM Match : RVT_1 (HMM E-Value=0.0028) 35 0.055 SB_51865| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.055 SB_46102| Best HMM Match : RVT_1 (HMM E-Value=2.6e-14) 35 0.055 SB_33858| Best HMM Match : RVT_1 (HMM E-Value=3.7e-21) 35 0.055 SB_28723| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.055 SB_27170| Best HMM Match : RVT_1 (HMM E-Value=1.3e-31) 35 0.055 SB_23584| Best HMM Match : RVT_1 (HMM E-Value=0.0029) 35 0.055 SB_21536| Best HMM Match : RVT_1 (HMM E-Value=0.0043) 35 0.055 SB_21388| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.055 SB_16275| Best HMM Match : RVT_1 (HMM E-Value=1.7e-16) 35 0.055 SB_15890| Best HMM Match : ArsC (HMM E-Value=0.94) 35 0.055 SB_15533| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.055 SB_10275| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.055 SB_6973| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.055 SB_4310| Best HMM Match : RVT_1 (HMM E-Value=5e-28) 35 0.055 SB_51225| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.073 SB_48543| Best HMM Match : Exo_endo_phos (HMM E-Value=7.8e-06) 35 0.073 SB_42059| Best HMM Match : RVT_1 (HMM E-Value=0.0011) 35 0.073 SB_40407| Best HMM Match : RVT_1 (HMM E-Value=9.4e-33) 35 0.073 SB_25962| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.073 SB_22943| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.073 SB_7972| Best HMM Match : RVT_1 (HMM E-Value=5.8e-29) 35 0.073 SB_7051| Best HMM Match : RVT_1 (HMM E-Value=0.064) 35 0.073 SB_54054| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.073 SB_47852| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.073 SB_45260| Best HMM Match : RVT_1 (HMM E-Value=1.2) 35 0.073 SB_43483| Best HMM Match : RVT_1 (HMM E-Value=9.4e-33) 35 0.073 SB_17341| Best HMM Match : RVT_1 (HMM E-Value=0.063) 35 0.073 SB_58643| Best HMM Match : RhoGAP (HMM E-Value=3.7) 34 0.096 SB_53893| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.096 SB_37794| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.096 SB_34933| Best HMM Match : RVT_1 (HMM E-Value=3.5e-08) 34 0.096 SB_23472| Best HMM Match : HIT (HMM E-Value=0.43) 34 0.096 SB_55944| Best HMM Match : RVT_1 (HMM E-Value=1.6e-11) 34 0.096 SB_52619| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.096 SB_50593| Best HMM Match : KIX (HMM E-Value=8) 34 0.096 SB_47464| Best HMM Match : RVT_1 (HMM E-Value=0.012) 34 0.096 SB_41708| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.096 SB_23136| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.096 SB_21912| Best HMM Match : RhoGAP (HMM E-Value=3.7) 34 0.096 SB_12628| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.096 SB_6740| Best HMM Match : RVT_1 (HMM E-Value=4.5e-22) 34 0.096 SB_6080| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.096 SB_2811| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.096 SB_56870| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.13 SB_48736| Best HMM Match : RVT_1 (HMM E-Value=1.4e-11) 34 0.13 SB_47354| Best HMM Match : RVT_1 (HMM E-Value=2e-07) 34 0.13 SB_41296| Best HMM Match : RVT_1 (HMM E-Value=2.8e-24) 34 0.13 SB_35188| Best HMM Match : RVT_1 (HMM E-Value=2.3e-25) 34 0.13 SB_34658| Best HMM Match : SUI1 (HMM E-Value=1e-06) 34 0.13 SB_23604| Best HMM Match : RVT_1 (HMM E-Value=4.6e-13) 34 0.13 SB_54734| Best HMM Match : RVT_1 (HMM E-Value=0.24) 34 0.13 SB_54439| Best HMM Match : SNF (HMM E-Value=0) 34 0.13 SB_53378| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.13 SB_44324| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.13 SB_19280| Best HMM Match : RVT_1 (HMM E-Value=3.5e-12) 34 0.13 SB_14807| Best HMM Match : RVT_1 (HMM E-Value=2.2) 34 0.13 SB_1234| Best HMM Match : RVT_1 (HMM E-Value=3.1e-08) 34 0.13 SB_59170| Best HMM Match : RVT_1 (HMM E-Value=0.13) 33 0.17 SB_47752| Best HMM Match : RVT_1 (HMM E-Value=0.047) 33 0.17 SB_45906| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.17 SB_33763| Best HMM Match : RVT_1 (HMM E-Value=3.1e-17) 33 0.17 SB_21896| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.17 SB_15987| Best HMM Match : RVT_1 (HMM E-Value=3.7e-27) 33 0.17 SB_6495| Best HMM Match : RVT_1 (HMM E-Value=1.2e-17) 33 0.17 SB_56575| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.17 SB_51319| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.17 SB_43942| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.17 SB_40027| Best HMM Match : RVT_1 (HMM E-Value=3.8e-11) 33 0.17 SB_38808| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.17 SB_37723| Best HMM Match : RVT_1 (HMM E-Value=0.054) 33 0.17 SB_22968| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.17 SB_5882| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.17 SB_267| Best HMM Match : RhoGAP (HMM E-Value=3.7) 33 0.17 SB_56872| Best HMM Match : RVT_1 (HMM E-Value=2.7e-30) 33 0.22 SB_53654| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.22 SB_51640| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.22 SB_46263| Best HMM Match : RVT_1 (HMM E-Value=2.2e-30) 33 0.22 SB_33347| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.22 SB_16177| Best HMM Match : SAM_1 (HMM E-Value=5.1) 33 0.22 SB_1034| Best HMM Match : RVT_1 (HMM E-Value=2.2e-30) 33 0.22 SB_57637| Best HMM Match : SRP40_C (HMM E-Value=2.3e-08) 33 0.22 SB_54423| Best HMM Match : RVT_1 (HMM E-Value=7.7e-32) 33 0.22 SB_51950| Best HMM Match : DUF1531 (HMM E-Value=3.3) 33 0.22 SB_50128| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.22 SB_44847| Best HMM Match : RVT_1 (HMM E-Value=0.00042) 33 0.22 SB_40130| Best HMM Match : SAM_1 (HMM E-Value=5.1) 33 0.22 SB_33932| Best HMM Match : RVT_1 (HMM E-Value=1.3e-19) 33 0.22 SB_33916| Best HMM Match : Hormone_2 (HMM E-Value=8.8) 33 0.22 SB_23528| Best HMM Match : RVT_1 (HMM E-Value=0.00042) 33 0.22 SB_16993| Best HMM Match : RVT_1 (HMM E-Value=0.35) 33 0.22 SB_10715| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.22 SB_7284| Best HMM Match : F5_F8_type_C (HMM E-Value=7.3e-10) 33 0.22 SB_2234| Best HMM Match : RVT_1 (HMM E-Value=1.3e-19) 33 0.22 SB_41660| Best HMM Match : PyrI_C (HMM E-Value=4.6) 33 0.29 SB_29603| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.29 SB_26381| Best HMM Match : RVT_1 (HMM E-Value=0.2) 33 0.29 SB_22944| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.29 SB_5866| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.29 SB_41460| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.29 SB_15796| Best HMM Match : RVT_1 (HMM E-Value=0.00082) 33 0.29 SB_15294| Best HMM Match : RVT_1 (HMM E-Value=0.00093) 33 0.29 SB_4166| Best HMM Match : RVT_1 (HMM E-Value=0.00088) 33 0.29 SB_46891| Best HMM Match : RVT_1 (HMM E-Value=1.6e-05) 32 0.39 SB_41944| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.39 SB_35755| Best HMM Match : RVT_1 (HMM E-Value=1.90001e-40) 32 0.39 SB_35248| Best HMM Match : DUF999 (HMM E-Value=2.7) 32 0.39 SB_29413| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.39 SB_29242| Best HMM Match : CIDE-N (HMM E-Value=5) 32 0.39 SB_28982| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.39 SB_21595| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.39 SB_17137| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.39 SB_13612| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.39 SB_56322| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.39 SB_48087| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.39 SB_47325| Best HMM Match : RVT_1 (HMM E-Value=2.2e-31) 32 0.39 SB_32455| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.39 SB_21258| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.39 SB_20463| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.39 SB_11402| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.39 SB_8622| Best HMM Match : RVT_1 (HMM E-Value=1.8e-35) 32 0.39 SB_4381| Best HMM Match : RVT_1 (HMM E-Value=3) 32 0.39 SB_59615| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.51 SB_57709| Best HMM Match : RVT_1 (HMM E-Value=0.00081) 32 0.51 SB_55435| Best HMM Match : RVT_1 (HMM E-Value=7.9e-22) 32 0.51 SB_51188| Best HMM Match : RVT_1 (HMM E-Value=4.5e-24) 32 0.51 SB_32869| Best HMM Match : Toxin_7 (HMM E-Value=3.9) 32 0.51 SB_29894| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.51 SB_21953| Best HMM Match : UME (HMM E-Value=6.1) 32 0.51 SB_20315| Best HMM Match : RVT_1 (HMM E-Value=1.4e-21) 32 0.51 SB_13947| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.51 SB_59736| Best HMM Match : RVT_1 (HMM E-Value=8.2e-31) 32 0.51 SB_56454| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.51 SB_45895| Best HMM Match : RVT_1 (HMM E-Value=0.00031) 32 0.51 SB_40728| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.51 SB_39302| Best HMM Match : SH3_2 (HMM E-Value=1.9e-38) 32 0.51 >SB_28157| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 605 Score = 50.4 bits (115), Expect = 1e-06 Identities = 22/34 (64%), Positives = 26/34 (76%) Frame = -1 Query: 229 VEGTRSRPRHVTAGVPQGSALSPLLFSLYINDIP 128 V+G S P VT+GVPQGS + PLLF LYIND+P Sbjct: 475 VDGEHSSPAIVTSGVPQGSVVGPLLFLLYINDLP 508 >SB_13395| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1308 Score = 50.4 bits (115), Expect = 1e-06 Identities = 22/34 (64%), Positives = 26/34 (76%) Frame = -1 Query: 229 VEGTRSRPRHVTAGVPQGSALSPLLFSLYINDIP 128 V+G S P VT+GVPQGS + PLLF LYIND+P Sbjct: 281 VDGEHSSPAIVTSGVPQGSVVGPLLFLLYINDLP 314 >SB_49600| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 1273 Score = 49.6 bits (113), Expect = 2e-06 Identities = 21/33 (63%), Positives = 26/33 (78%) Frame = -1 Query: 226 EGTRSRPRHVTAGVPQGSALSPLLFSLYINDIP 128 +G RS P VT+GVPQG+ L PLLF LY+ND+P Sbjct: 755 DGKRSCPSLVTSGVPQGTVLGPLLFLLYVNDLP 787 >SB_26135| Best HMM Match : RVT_1 (HMM E-Value=0.072) Length = 375 Score = 49.6 bits (113), Expect = 2e-06 Identities = 21/33 (63%), Positives = 26/33 (78%) Frame = -1 Query: 226 EGTRSRPRHVTAGVPQGSALSPLLFSLYINDIP 128 +G RS P VT+GVPQG+ L PLLF LY+ND+P Sbjct: 61 DGKRSCPSLVTSGVPQGTVLGPLLFLLYVNDLP 93 >SB_19328| Best HMM Match : RVT_1 (HMM E-Value=2e-36) Length = 295 Score = 49.6 bits (113), Expect = 2e-06 Identities = 21/33 (63%), Positives = 26/33 (78%) Frame = -1 Query: 226 EGTRSRPRHVTAGVPQGSALSPLLFSLYINDIP 128 +G RS P VT+GVPQG+ L PLLF LY+ND+P Sbjct: 157 DGKRSCPSLVTSGVPQGTVLGPLLFLLYVNDLP 189 >SB_2897| Best HMM Match : RVT_1 (HMM E-Value=3e-33) Length = 609 Score = 49.6 bits (113), Expect = 2e-06 Identities = 21/33 (63%), Positives = 26/33 (78%) Frame = -1 Query: 226 EGTRSRPRHVTAGVPQGSALSPLLFSLYINDIP 128 +G RS P VT+GVPQG+ L PLLF LY+ND+P Sbjct: 293 DGKRSCPSLVTSGVPQGTVLGPLLFLLYVNDLP 325 >SB_1793| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 864 Score = 49.6 bits (113), Expect = 2e-06 Identities = 21/33 (63%), Positives = 26/33 (78%) Frame = -1 Query: 226 EGTRSRPRHVTAGVPQGSALSPLLFSLYINDIP 128 +G RS P VT+GVPQG+ L PLLF LY+ND+P Sbjct: 477 DGKRSCPSLVTSGVPQGTVLGPLLFLLYVNDLP 509 >SB_43541| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 581 Score = 49.6 bits (113), Expect = 2e-06 Identities = 21/33 (63%), Positives = 26/33 (78%) Frame = -1 Query: 226 EGTRSRPRHVTAGVPQGSALSPLLFSLYINDIP 128 +G RS P VT+GVPQG+ L PLLF LY+ND+P Sbjct: 267 DGKRSCPSLVTSGVPQGTVLGPLLFLLYVNDLP 299 >SB_41552| Best HMM Match : RVT_1 (HMM E-Value=5.4e-32) Length = 1241 Score = 49.6 bits (113), Expect = 2e-06 Identities = 21/33 (63%), Positives = 26/33 (78%) Frame = -1 Query: 226 EGTRSRPRHVTAGVPQGSALSPLLFSLYINDIP 128 +G RS P VT+GVPQG+ L PLLF LY+ND+P Sbjct: 633 DGKRSCPSLVTSGVPQGTVLGPLLFLLYVNDLP 665 >SB_20131| Best HMM Match : RVT_1 (HMM E-Value=0.0049) Length = 186 Score = 49.6 bits (113), Expect = 2e-06 Identities = 22/34 (64%), Positives = 26/34 (76%) Frame = -1 Query: 229 VEGTRSRPRHVTAGVPQGSALSPLLFSLYINDIP 128 V+G S P VT+GVPQGS + PLLF LYIND+P Sbjct: 74 VDGEHSSPVIVTSGVPQGSVVGPLLFLLYINDLP 107 >SB_20120| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 666 Score = 49.6 bits (113), Expect = 2e-06 Identities = 21/33 (63%), Positives = 26/33 (78%) Frame = -1 Query: 226 EGTRSRPRHVTAGVPQGSALSPLLFSLYINDIP 128 +G RS P VT+GVPQG+ L PLLF LY+ND+P Sbjct: 352 DGKRSCPSLVTSGVPQGTVLGPLLFLLYVNDLP 384 >SB_18871| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 546 Score = 49.6 bits (113), Expect = 2e-06 Identities = 21/33 (63%), Positives = 26/33 (78%) Frame = -1 Query: 226 EGTRSRPRHVTAGVPQGSALSPLLFSLYINDIP 128 +G RS P VT+GVPQG+ L PLLF LY+ND+P Sbjct: 285 DGKRSCPSLVTSGVPQGTVLGPLLFLLYVNDLP 317 >SB_56449| Best HMM Match : RVT_1 (HMM E-Value=0.28) Length = 419 Score = 48.8 bits (111), Expect = 4e-06 Identities = 25/42 (59%), Positives = 27/42 (64%) Frame = -1 Query: 256 LGNSSFRYRVEGTRSRPRHVTAGVPQGSALSPLLFSLYINDI 131 L N S V G+ S HVT+GVPQGS L P LF LYINDI Sbjct: 342 LRNRSQYVIVNGSHSSKVHVTSGVPQGSVLGPTLFLLYINDI 383 >SB_32446| Best HMM Match : RVT_1 (HMM E-Value=0.04) Length = 197 Score = 48.8 bits (111), Expect = 4e-06 Identities = 25/42 (59%), Positives = 27/42 (64%) Frame = -1 Query: 256 LGNSSFRYRVEGTRSRPRHVTAGVPQGSALSPLLFSLYINDI 131 L N S V G+ S HVT+GVPQGS L P LF LYINDI Sbjct: 70 LRNRSQYVVVNGSHSSKVHVTSGVPQGSVLGPTLFLLYINDI 111 >SB_32070| Best HMM Match : RVT_1 (HMM E-Value=2.4e-15) Length = 345 Score = 48.8 bits (111), Expect = 4e-06 Identities = 25/42 (59%), Positives = 27/42 (64%) Frame = -1 Query: 256 LGNSSFRYRVEGTRSRPRHVTAGVPQGSALSPLLFSLYINDI 131 L N S V G+ S HVT+GVPQGS L P LF LYINDI Sbjct: 180 LRNRSQYVVVNGSHSSKVHVTSGVPQGSVLGPTLFLLYINDI 221 >SB_2746| Best HMM Match : RVT_1 (HMM E-Value=1.10002e-42) Length = 330 Score = 48.8 bits (111), Expect = 4e-06 Identities = 25/42 (59%), Positives = 27/42 (64%) Frame = -1 Query: 256 LGNSSFRYRVEGTRSRPRHVTAGVPQGSALSPLLFSLYINDI 131 L N S V G+ S HVT+GVPQGS L P LF LYINDI Sbjct: 203 LRNRSQYVVVNGSHSSKVHVTSGVPQGSVLGPTLFLLYINDI 244 >SB_2102| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2396 Score = 48.8 bits (111), Expect = 4e-06 Identities = 25/42 (59%), Positives = 27/42 (64%) Frame = -1 Query: 256 LGNSSFRYRVEGTRSRPRHVTAGVPQGSALSPLLFSLYINDI 131 L N S V G+ S HVT+GVPQGS L P LF LYINDI Sbjct: 1741 LRNRSQYVVVNGSHSSKVHVTSGVPQGSVLGPTLFLLYINDI 1782 Score = 40.7 bits (91), Expect = 0.001 Identities = 17/34 (50%), Positives = 23/34 (67%) Frame = -1 Query: 229 VEGTRSRPRHVTAGVPQGSALSPLLFSLYINDIP 128 + G S + TAG+PQ S L PL+F L+IND+P Sbjct: 788 ISGQLSDSQPFTAGIPQSSILGPLMFILFINDLP 821 Score = 40.3 bits (90), Expect = 0.001 Identities = 20/48 (41%), Positives = 29/48 (60%) Frame = -1 Query: 271 YTRHILGNSSFRYRVEGTRSRPRHVTAGVPQGSALSPLLFSLYINDIP 128 + R+ L + R V G S V +GVPQG+ L P+LF ++IND+P Sbjct: 1929 WLRNFLIDRRQRVVVNGACSSWSTVLSGVPQGTVLGPILFLMFINDMP 1976 Score = 30.3 bits (65), Expect = 1.6 Identities = 14/23 (60%), Positives = 16/23 (69%) Frame = -1 Query: 199 VTAGVPQGSALSPLLFSLYINDI 131 V AGV QG+ L P LF L IND+ Sbjct: 459 VPAGVQQGTKLGPWLFILIINDL 481 >SB_55880| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 859 Score = 48.8 bits (111), Expect = 4e-06 Identities = 25/42 (59%), Positives = 27/42 (64%) Frame = -1 Query: 256 LGNSSFRYRVEGTRSRPRHVTAGVPQGSALSPLLFSLYINDI 131 L N S V G+ S HVT+GVPQGS L P LF LYINDI Sbjct: 769 LRNRSQYVVVNGSHSSKVHVTSGVPQGSVLGPTLFLLYINDI 810 >SB_29272| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 719 Score = 48.8 bits (111), Expect = 4e-06 Identities = 21/33 (63%), Positives = 26/33 (78%) Frame = -1 Query: 226 EGTRSRPRHVTAGVPQGSALSPLLFSLYINDIP 128 +G RS P VT+GVPQG+ L PLLF LY+ND+P Sbjct: 469 DGKRSCPSLVTSGVPQGTVLGPLLFLLYMNDLP 501 >SB_10927| Best HMM Match : RVT_1 (HMM E-Value=6.6e-39) Length = 452 Score = 48.8 bits (111), Expect = 4e-06 Identities = 25/42 (59%), Positives = 27/42 (64%) Frame = -1 Query: 256 LGNSSFRYRVEGTRSRPRHVTAGVPQGSALSPLLFSLYINDI 131 L N S V G+ S HVT+GVPQGS L P LF LYINDI Sbjct: 122 LRNRSQYVVVNGSHSSKVHVTSGVPQGSVLGPTLFLLYINDI 163 >SB_5114| Best HMM Match : RVT_1 (HMM E-Value=1.10002e-42) Length = 330 Score = 48.8 bits (111), Expect = 4e-06 Identities = 25/42 (59%), Positives = 27/42 (64%) Frame = -1 Query: 256 LGNSSFRYRVEGTRSRPRHVTAGVPQGSALSPLLFSLYINDI 131 L N S V G+ S HVT+GVPQGS L P LF LYINDI Sbjct: 203 LRNRSQYVVVNGSHSSKVHVTSGVPQGSVLGPTLFLLYINDI 244 >SB_41513| Best HMM Match : RVT_1 (HMM E-Value=8.9e-21) Length = 1080 Score = 48.4 bits (110), Expect = 6e-06 Identities = 22/42 (52%), Positives = 30/42 (71%) Frame = -1 Query: 256 LGNSSFRYRVEGTRSRPRHVTAGVPQGSALSPLLFSLYINDI 131 L N + R V+G S+P VT+GVPQG+ L PL+F L+IND+ Sbjct: 619 LTNRTQRVVVDGVSSKPVDVTSGVPQGTVLGPLMFLLFINDM 660 >SB_30812| Best HMM Match : RVT_1 (HMM E-Value=1.2e-40) Length = 325 Score = 48.4 bits (110), Expect = 6e-06 Identities = 22/42 (52%), Positives = 30/42 (71%) Frame = -1 Query: 256 LGNSSFRYRVEGTRSRPRHVTAGVPQGSALSPLLFSLYINDI 131 L N + R V+G S+P VT+GVPQG+ L PL+F L+IND+ Sbjct: 220 LTNRTQRVVVDGVSSKPVDVTSGVPQGTVLGPLMFLLFINDM 261 >SB_30053| Best HMM Match : RVT_1 (HMM E-Value=2.3e-24) Length = 232 Score = 48.4 bits (110), Expect = 6e-06 Identities = 21/41 (51%), Positives = 28/41 (68%) Frame = -1 Query: 250 NSSFRYRVEGTRSRPRHVTAGVPQGSALSPLLFSLYINDIP 128 N + R V + S P+ +T G+PQG+ L PLLF LYIND+P Sbjct: 118 NRTQRCSVNNSLSGPKFLTCGIPQGTILGPLLFLLYINDLP 158 >SB_27128| Best HMM Match : PADR1 (HMM E-Value=8.3) Length = 242 Score = 48.4 bits (110), Expect = 6e-06 Identities = 22/42 (52%), Positives = 30/42 (71%) Frame = -1 Query: 256 LGNSSFRYRVEGTRSRPRHVTAGVPQGSALSPLLFSLYINDI 131 L N + R V+G S+P VT+GVPQG+ L PL+F L+IND+ Sbjct: 39 LTNRTQRVVVDGVSSKPVDVTSGVPQGTVLGPLMFLLFINDM 80 >SB_11753| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 393 Score = 48.4 bits (110), Expect = 6e-06 Identities = 22/42 (52%), Positives = 30/42 (71%) Frame = -1 Query: 256 LGNSSFRYRVEGTRSRPRHVTAGVPQGSALSPLLFSLYINDI 131 L N + R V+G S+P VT+GVPQG+ L PL+F L+IND+ Sbjct: 220 LTNRTQRVVVDGVSSKPVDVTSGVPQGTVLGPLMFLLFINDM 261 >SB_9212| Best HMM Match : RVT_1 (HMM E-Value=4.5e-36) Length = 449 Score = 48.4 bits (110), Expect = 6e-06 Identities = 23/48 (47%), Positives = 29/48 (60%) Frame = -1 Query: 271 YTRHILGNSSFRYRVEGTRSRPRHVTAGVPQGSALSPLLFSLYINDIP 128 + R L S + V G S PR ++ GVPQGS L PL F LY+ND+P Sbjct: 323 WIRSYLTGRSQKCFVNGDLSSPRPISCGVPQGSILGPLRFLLYVNDLP 370 >SB_7615| Best HMM Match : RVT_1 (HMM E-Value=1e-33) Length = 363 Score = 48.4 bits (110), Expect = 6e-06 Identities = 22/42 (52%), Positives = 30/42 (71%) Frame = -1 Query: 256 LGNSSFRYRVEGTRSRPRHVTAGVPQGSALSPLLFSLYINDI 131 L N + R V+G S+P VT+GVPQG+ L PL+F L+IND+ Sbjct: 160 LTNRTQRVVVDGVSSKPVDVTSGVPQGTVLGPLMFLLFINDM 201 >SB_5465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 810 Score = 48.4 bits (110), Expect = 6e-06 Identities = 21/34 (61%), Positives = 25/34 (73%) Frame = -1 Query: 229 VEGTRSRPRHVTAGVPQGSALSPLLFSLYINDIP 128 V+G S P VT+GVP GS + PLLF LYIND+P Sbjct: 683 VDGEHSSPAIVTSGVPHGSVVGPLLFLLYINDLP 716 >SB_24534| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 423 Score = 48.4 bits (110), Expect = 6e-06 Identities = 22/42 (52%), Positives = 30/42 (71%) Frame = -1 Query: 256 LGNSSFRYRVEGTRSRPRHVTAGVPQGSALSPLLFSLYINDI 131 L N + R V+G S+P VT+GVPQG+ L PL+F L+IND+ Sbjct: 220 LTNRTQRVVVDGVSSKPVDVTSGVPQGTVLGPLMFLLFINDM 261 >SB_1851| Best HMM Match : RVT_1 (HMM E-Value=3.2e-16) Length = 287 Score = 48.4 bits (110), Expect = 6e-06 Identities = 22/42 (52%), Positives = 30/42 (71%) Frame = -1 Query: 256 LGNSSFRYRVEGTRSRPRHVTAGVPQGSALSPLLFSLYINDI 131 L N + R V+G S+P VT+GVPQG+ L PL+F L+IND+ Sbjct: 84 LTNRTQRVVVDGVSSKPVDVTSGVPQGTVLGPLMFLLFINDM 125 >SB_58595| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1462 Score = 48.0 bits (109), Expect = 7e-06 Identities = 23/45 (51%), Positives = 29/45 (64%) Frame = -1 Query: 262 HILGNSSFRYRVEGTRSRPRHVTAGVPQGSALSPLLFSLYINDIP 128 H L + + V+G S P V +GVPQGS L PLLF +YIND+P Sbjct: 685 HYLSDRTQCTVVQGATSSPLPVLSGVPQGSLLGPLLFLVYINDLP 729 >SB_57671| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 533 Score = 48.0 bits (109), Expect = 7e-06 Identities = 23/48 (47%), Positives = 29/48 (60%) Frame = -1 Query: 271 YTRHILGNSSFRYRVEGTRSRPRHVTAGVPQGSALSPLLFSLYINDIP 128 + RH L N R V G S V +GVPQG+ L P+LF L+IND+P Sbjct: 261 WLRHFLTNRRQRVVVNGASSTWSPVLSGVPQGTVLGPILFLLFINDLP 308 >SB_53367| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 1025 Score = 48.0 bits (109), Expect = 7e-06 Identities = 23/48 (47%), Positives = 29/48 (60%) Frame = -1 Query: 271 YTRHILGNSSFRYRVEGTRSRPRHVTAGVPQGSALSPLLFSLYINDIP 128 + RH L N R V G S V +GVPQG+ L P+LF L+IND+P Sbjct: 773 WLRHFLTNRRQRVVVNGASSTWSPVLSGVPQGTVLGPILFLLFINDLP 820 >SB_6954| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 943 Score = 48.0 bits (109), Expect = 7e-06 Identities = 23/45 (51%), Positives = 29/45 (64%) Frame = -1 Query: 262 HILGNSSFRYRVEGTRSRPRHVTAGVPQGSALSPLLFSLYINDIP 128 H L + + V+G S P V +GVPQGS L PLLF +YIND+P Sbjct: 276 HYLSDRTQCTVVQGATSSPLPVLSGVPQGSLLGPLLFLVYINDLP 320 >SB_50273| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 253 Score = 48.0 bits (109), Expect = 7e-06 Identities = 23/45 (51%), Positives = 29/45 (64%) Frame = -1 Query: 262 HILGNSSFRYRVEGTRSRPRHVTAGVPQGSALSPLLFSLYINDIP 128 H L N + ++G S P V +GVPQGS L PLLF +YIND+P Sbjct: 154 HALLNRTQCTVIQGATSSPLPVLSGVPQGSLLGPLLFLVYINDLP 198 >SB_35779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 305 Score = 48.0 bits (109), Expect = 7e-06 Identities = 23/48 (47%), Positives = 29/48 (60%) Frame = -1 Query: 271 YTRHILGNSSFRYRVEGTRSRPRHVTAGVPQGSALSPLLFSLYINDIP 128 + RH L N R V G S V +GVPQG+ L P+LF L+IND+P Sbjct: 79 WLRHFLTNRRQRVVVNGASSTWSPVLSGVPQGTVLGPILFLLFINDLP 126 >SB_30833| Best HMM Match : RVT_1 (HMM E-Value=3.50044e-42) Length = 275 Score = 48.0 bits (109), Expect = 7e-06 Identities = 23/48 (47%), Positives = 29/48 (60%) Frame = -1 Query: 271 YTRHILGNSSFRYRVEGTRSRPRHVTAGVPQGSALSPLLFSLYINDIP 128 + RH L N R V G S V +GVPQG+ L P+LF L+IND+P Sbjct: 170 WLRHFLTNRRQRVVVNGASSTWSPVLSGVPQGTVLGPILFLLFINDLP 217 >SB_17278| Best HMM Match : RVT_1 (HMM E-Value=0.0082) Length = 506 Score = 48.0 bits (109), Expect = 7e-06 Identities = 22/33 (66%), Positives = 24/33 (72%) Frame = -1 Query: 229 VEGTRSRPRHVTAGVPQGSALSPLLFSLYINDI 131 V G+ S HVT+GVPQGS L P LF LYINDI Sbjct: 185 VNGSHSSKVHVTSGVPQGSVLGPTLFLLYINDI 217 >SB_11838| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 1009 Score = 48.0 bits (109), Expect = 7e-06 Identities = 23/48 (47%), Positives = 29/48 (60%) Frame = -1 Query: 271 YTRHILGNSSFRYRVEGTRSRPRHVTAGVPQGSALSPLLFSLYINDIP 128 + RH L N R V G S V +GVPQG+ L P+LF L+IND+P Sbjct: 705 WLRHFLTNRRQRVVVNGASSTWSPVLSGVPQGTVLGPILFLLFINDLP 752 >SB_51334| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1402 Score = 47.6 bits (108), Expect = 1e-05 Identities = 21/33 (63%), Positives = 25/33 (75%) Frame = -1 Query: 229 VEGTRSRPRHVTAGVPQGSALSPLLFSLYINDI 131 V+G S P VT+GVPQG+ L PL+F LYINDI Sbjct: 655 VDGVSSAPISVTSGVPQGTVLGPLMFLLYINDI 687 >SB_31162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 47.6 bits (108), Expect = 1e-05 Identities = 22/42 (52%), Positives = 30/42 (71%) Frame = -1 Query: 256 LGNSSFRYRVEGTRSRPRHVTAGVPQGSALSPLLFSLYINDI 131 L N + R V+G +P VT+GVPQG+AL PL+F L+IND+ Sbjct: 98 LTNRTERVVVDGVSLKPVDVTSGVPQGTALGPLMFLLFINDM 139 >SB_47691| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 47.2 bits (107), Expect = 1e-05 Identities = 21/34 (61%), Positives = 25/34 (73%) Frame = -1 Query: 229 VEGTRSRPRHVTAGVPQGSALSPLLFSLYINDIP 128 V+G S P VT+GVPQGS + LLF LYIND+P Sbjct: 76 VDGEHSSPAIVTSGVPQGSVVGSLLFLLYINDLP 109 >SB_35764| Best HMM Match : RVT_1 (HMM E-Value=8.1e-13) Length = 362 Score = 47.2 bits (107), Expect = 1e-05 Identities = 25/47 (53%), Positives = 29/47 (61%) Frame = -1 Query: 268 TRHILGNSSFRYRVEGTRSRPRHVTAGVPQGSALSPLLFSLYINDIP 128 TR + GN Y V G S VT+GVPQGS L P+LF LY ND+P Sbjct: 164 TRVVSGNL---YTVLGCTSSEASVTSGVPQGSLLGPILFLLYANDLP 207 >SB_33398| Best HMM Match : Sorb (HMM E-Value=9.9) Length = 347 Score = 47.2 bits (107), Expect = 1e-05 Identities = 20/43 (46%), Positives = 27/43 (62%) Frame = -1 Query: 256 LGNSSFRYRVEGTRSRPRHVTAGVPQGSALSPLLFSLYINDIP 128 L N ++++ T S +T G+PQGS L PL F LYIND+P Sbjct: 19 LSNRKRKHQLNSTVSSESKITCGIPQGSILGPLFFLLYINDLP 61 >SB_27893| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 201 Score = 47.2 bits (107), Expect = 1e-05 Identities = 25/47 (53%), Positives = 29/47 (61%) Frame = -1 Query: 268 TRHILGNSSFRYRVEGTRSRPRHVTAGVPQGSALSPLLFSLYINDIP 128 TR + GN Y V G S VT+GVPQGS L P+LF LY ND+P Sbjct: 3 TRVVSGNL---YTVLGCTSSEASVTSGVPQGSLLGPILFLLYANDLP 46 >SB_14910| Best HMM Match : RVT_1 (HMM E-Value=0.47) Length = 193 Score = 46.8 bits (106), Expect = 2e-05 Identities = 23/43 (53%), Positives = 26/43 (60%) Frame = -1 Query: 256 LGNSSFRYRVEGTRSRPRHVTAGVPQGSALSPLLFSLYINDIP 128 L N R V G S VT+GVPQGS L P+LF LY ND+P Sbjct: 69 LSNRRQRVTVLGFTSSEASVTSGVPQGSLLGPILFCLYANDLP 111 >SB_22738| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 296 Score = 46.8 bits (106), Expect = 2e-05 Identities = 22/43 (51%), Positives = 27/43 (62%) Frame = -1 Query: 256 LGNSSFRYRVEGTRSRPRHVTAGVPQGSALSPLLFSLYINDIP 128 L N + V S+PR +T GVPQGS L PLLF +YI D+P Sbjct: 55 LSNRKQQCMVNWHLSKPRTITCGVPQGSILGPLLFLIYIYDLP 97 >SB_40804| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1044 Score = 46.4 bits (105), Expect = 2e-05 Identities = 22/48 (45%), Positives = 31/48 (64%) Frame = -1 Query: 271 YTRHILGNSSFRYRVEGTRSRPRHVTAGVPQGSALSPLLFSLYINDIP 128 + + +L N + V+G S VT+GVPQGS + PLLF L+IND+P Sbjct: 783 WLKDLLSNRTQAVLVDGEISPSCDVTSGVPQGSVVRPLLFLLFINDLP 830 >SB_37835| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 295 Score = 46.4 bits (105), Expect = 2e-05 Identities = 22/48 (45%), Positives = 28/48 (58%) Frame = -1 Query: 271 YTRHILGNSSFRYRVEGTRSRPRHVTAGVPQGSALSPLLFSLYINDIP 128 + RH N R V G S V +GVPQG+ L P+LF L+IND+P Sbjct: 171 WLRHFFTNRRQRVVVNGASSTWSPVLSGVPQGTVLGPILFLLFINDLP 218 >SB_46139| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 509 Score = 46.0 bits (104), Expect = 3e-05 Identities = 20/33 (60%), Positives = 25/33 (75%) Frame = -1 Query: 229 VEGTRSRPRHVTAGVPQGSALSPLLFSLYINDI 131 VEG S+ VT+GVPQG+ L PL+F L+INDI Sbjct: 218 VEGETSKSTRVTSGVPQGTVLGPLMFLLFINDI 250 >SB_25338| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1360 Score = 46.0 bits (104), Expect = 3e-05 Identities = 22/47 (46%), Positives = 29/47 (61%) Frame = -1 Query: 271 YTRHILGNSSFRYRVEGTRSRPRHVTAGVPQGSALSPLLFSLYINDI 131 + + + N V GT S + V +GVPQGS LSP+LF L+INDI Sbjct: 644 WIKAFVSNRKQSVSVNGTVSSSKSVVSGVPQGSVLSPVLFLLFINDI 690 >SB_24803| Best HMM Match : LRR_1 (HMM E-Value=0.0066) Length = 727 Score = 46.0 bits (104), Expect = 3e-05 Identities = 20/33 (60%), Positives = 25/33 (75%) Frame = -1 Query: 229 VEGTRSRPRHVTAGVPQGSALSPLLFSLYINDI 131 VEG S+ VT+GVPQG+ L PL+F L+INDI Sbjct: 75 VEGETSKSTRVTSGVPQGTVLGPLMFLLFINDI 107 >SB_18966| Best HMM Match : RVT_1 (HMM E-Value=0.028) Length = 252 Score = 46.0 bits (104), Expect = 3e-05 Identities = 20/33 (60%), Positives = 25/33 (75%) Frame = -1 Query: 229 VEGTRSRPRHVTAGVPQGSALSPLLFSLYINDI 131 V+G S P V++GVPQG+ L PL+F LYINDI Sbjct: 188 VDGVSSAPISVSSGVPQGTVLGPLMFLLYINDI 220 >SB_12308| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 907 Score = 46.0 bits (104), Expect = 3e-05 Identities = 20/33 (60%), Positives = 25/33 (75%) Frame = -1 Query: 229 VEGTRSRPRHVTAGVPQGSALSPLLFSLYINDI 131 VEG S+ VT+GVPQG+ L PL+F L+INDI Sbjct: 703 VEGETSKSTRVTSGVPQGTVLGPLMFLLFINDI 735 >SB_576| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 1444 Score = 46.0 bits (104), Expect = 3e-05 Identities = 22/55 (40%), Positives = 32/55 (58%) Frame = -1 Query: 286 SFTF*YTRHILGNSSFRYRVEGTRSRPRHVTAGVPQGSALSPLLFSLYINDIPRY 122 SF T ++ G F +++ SR V GVPQGS L P+LF+LY+ND+ + Sbjct: 836 SFLMWVTSYLTGRKQF-VQIDDKSSRLADVCLGVPQGSVLGPVLFNLYVNDLSEH 889 >SB_52166| Best HMM Match : Exo_endo_phos (HMM E-Value=5.6e-10) Length = 805 Score = 46.0 bits (104), Expect = 3e-05 Identities = 20/33 (60%), Positives = 25/33 (75%) Frame = -1 Query: 229 VEGTRSRPRHVTAGVPQGSALSPLLFSLYINDI 131 VEG S+ VT+GVPQG+ L PL+F L+INDI Sbjct: 601 VEGETSKSTRVTSGVPQGTVLGPLMFLLFINDI 633 >SB_49562| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 734 Score = 46.0 bits (104), Expect = 3e-05 Identities = 20/33 (60%), Positives = 25/33 (75%) Frame = -1 Query: 229 VEGTRSRPRHVTAGVPQGSALSPLLFSLYINDI 131 V+G S P V++GVPQG+ L PL+F LYINDI Sbjct: 273 VDGVSSAPISVSSGVPQGTVLGPLMFLLYINDI 305 >SB_42505| Best HMM Match : RVT_1 (HMM E-Value=3.9e-18) Length = 264 Score = 46.0 bits (104), Expect = 3e-05 Identities = 20/33 (60%), Positives = 25/33 (75%) Frame = -1 Query: 229 VEGTRSRPRHVTAGVPQGSALSPLLFSLYINDI 131 V+G S P V++GVPQG+ L PL+F LYINDI Sbjct: 93 VDGVSSAPISVSSGVPQGTVLGPLMFLLYINDI 125 >SB_40344| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 401 Score = 46.0 bits (104), Expect = 3e-05 Identities = 20/33 (60%), Positives = 25/33 (75%) Frame = -1 Query: 229 VEGTRSRPRHVTAGVPQGSALSPLLFSLYINDI 131 V+G S P V++GVPQG+ L PL+F LYINDI Sbjct: 93 VDGVSSAPISVSSGVPQGTVLGPLMFLLYINDI 125 >SB_25064| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1134 Score = 46.0 bits (104), Expect = 3e-05 Identities = 20/33 (60%), Positives = 25/33 (75%) Frame = -1 Query: 229 VEGTRSRPRHVTAGVPQGSALSPLLFSLYINDI 131 V+G S P V++GVPQG+ L PL+F LYINDI Sbjct: 772 VDGVSSAPISVSSGVPQGTVLGPLMFLLYINDI 804 >SB_23493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1230 Score = 46.0 bits (104), Expect = 3e-05 Identities = 20/33 (60%), Positives = 25/33 (75%) Frame = -1 Query: 229 VEGTRSRPRHVTAGVPQGSALSPLLFSLYINDI 131 VEG S+ VT+GVPQG+ L PL+F L+INDI Sbjct: 1072 VEGETSKSTRVTSGVPQGTVLGPLMFLLFINDI 1104 >SB_18909| Best HMM Match : RVT_1 (HMM E-Value=1.2e-28) Length = 591 Score = 46.0 bits (104), Expect = 3e-05 Identities = 20/33 (60%), Positives = 25/33 (75%) Frame = -1 Query: 229 VEGTRSRPRHVTAGVPQGSALSPLLFSLYINDI 131 VEG S+ VT+GVPQG+ L PL+F L+INDI Sbjct: 192 VEGETSKSTRVTSGVPQGTVLGPLMFLLFINDI 224 >SB_12008| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 979 Score = 46.0 bits (104), Expect = 3e-05 Identities = 20/33 (60%), Positives = 25/33 (75%) Frame = -1 Query: 229 VEGTRSRPRHVTAGVPQGSALSPLLFSLYINDI 131 V+G S P V++GVPQG+ L PL+F LYINDI Sbjct: 228 VDGVSSAPISVSSGVPQGTVLGPLMFLLYINDI 260 >SB_10154| Best HMM Match : RVT_1 (HMM E-Value=4.3e-17) Length = 264 Score = 46.0 bits (104), Expect = 3e-05 Identities = 20/33 (60%), Positives = 25/33 (75%) Frame = -1 Query: 229 VEGTRSRPRHVTAGVPQGSALSPLLFSLYINDI 131 V+G S P V++GVPQG+ L PL+F LYINDI Sbjct: 93 VDGVSSAPISVSSGVPQGTVLGPLMFLLYINDI 125 >SB_6960| Best HMM Match : RVT_1 (HMM E-Value=1.6e-21) Length = 229 Score = 46.0 bits (104), Expect = 3e-05 Identities = 22/55 (40%), Positives = 32/55 (58%) Frame = -1 Query: 286 SFTF*YTRHILGNSSFRYRVEGTRSRPRHVTAGVPQGSALSPLLFSLYINDIPRY 122 SF T ++ G F +++ SR V GVPQGS L P+LF+LY+ND+ + Sbjct: 78 SFLMWVTSYLTGRKQF-VQIDDKSSRLADVCLGVPQGSVLGPVLFNLYVNDLSEH 131 >SB_45791| Best HMM Match : Ribosomal_L30_N (HMM E-Value=0.2) Length = 304 Score = 45.6 bits (103), Expect = 4e-05 Identities = 21/39 (53%), Positives = 26/39 (66%) Frame = -1 Query: 238 RYRVEGTRSRPRHVTAGVPQGSALSPLLFSLYINDIPRY 122 R ++G S VT+GVPQGS L PLLF +Y ND+P Y Sbjct: 257 RVVLDGVSSSWLSVTSGVPQGSILGPLLFLVYANDMPNY 295 >SB_42669| Best HMM Match : Sorb (HMM E-Value=9.2) Length = 347 Score = 45.6 bits (103), Expect = 4e-05 Identities = 20/43 (46%), Positives = 26/43 (60%) Frame = -1 Query: 256 LGNSSFRYRVEGTRSRPRHVTAGVPQGSALSPLLFSLYINDIP 128 L N + ++ T S +T G+PQGS L PL F LYIND+P Sbjct: 19 LSNRKQKCQLNSTVSSESKITCGIPQGSILGPLFFLLYINDLP 61 >SB_33087| Best HMM Match : Fascin (HMM E-Value=8.9) Length = 347 Score = 45.6 bits (103), Expect = 4e-05 Identities = 20/43 (46%), Positives = 26/43 (60%) Frame = -1 Query: 256 LGNSSFRYRVEGTRSRPRHVTAGVPQGSALSPLLFSLYINDIP 128 L N + ++ T S +T G+PQGS L PL F LYIND+P Sbjct: 19 LSNRKQKCQLNSTVSSESKITCGIPQGSILGPLFFLLYINDLP 61 >SB_30852| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 623 Score = 45.6 bits (103), Expect = 4e-05 Identities = 20/43 (46%), Positives = 26/43 (60%) Frame = -1 Query: 256 LGNSSFRYRVEGTRSRPRHVTAGVPQGSALSPLLFSLYINDIP 128 L N + ++ T S +T G+PQGS L PL F LYIND+P Sbjct: 302 LSNRKQKCQLNSTVSSESKITCGIPQGSILGPLFFLLYINDLP 344 >SB_26585| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 317 Score = 45.6 bits (103), Expect = 4e-05 Identities = 20/43 (46%), Positives = 26/43 (60%) Frame = -1 Query: 256 LGNSSFRYRVEGTRSRPRHVTAGVPQGSALSPLLFSLYINDIP 128 L N + ++ T S +T G+PQGS L PL F LYIND+P Sbjct: 128 LSNRKQKCQLNSTVSSESKITCGIPQGSILGPLFFLLYINDLP 170 >SB_13686| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 208 Score = 45.6 bits (103), Expect = 4e-05 Identities = 20/43 (46%), Positives = 26/43 (60%) Frame = -1 Query: 256 LGNSSFRYRVEGTRSRPRHVTAGVPQGSALSPLLFSLYINDIP 128 L N + ++ T S +T G+PQGS L PL F LYIND+P Sbjct: 19 LSNRKQKCQLNSTVSSESKITCGIPQGSILGPLFFLLYINDLP 61 >SB_6247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 917 Score = 45.6 bits (103), Expect = 4e-05 Identities = 20/43 (46%), Positives = 26/43 (60%) Frame = -1 Query: 256 LGNSSFRYRVEGTRSRPRHVTAGVPQGSALSPLLFSLYINDIP 128 L N + ++ T S +T G+PQGS L PL F LYIND+P Sbjct: 546 LSNRKQKCQLNSTVSSESKITCGIPQGSILGPLFFLLYINDLP 588 >SB_42310| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 940 Score = 45.6 bits (103), Expect = 4e-05 Identities = 20/43 (46%), Positives = 26/43 (60%) Frame = -1 Query: 256 LGNSSFRYRVEGTRSRPRHVTAGVPQGSALSPLLFSLYINDIP 128 L N + ++ T S +T G+PQGS L PL F LYIND+P Sbjct: 612 LSNRKQKCQLNSTVSSESKITCGIPQGSILGPLFFLLYINDLP 654 >SB_31875| Best HMM Match : SNF2_N (HMM E-Value=0) Length = 1478 Score = 45.6 bits (103), Expect = 4e-05 Identities = 20/43 (46%), Positives = 26/43 (60%) Frame = -1 Query: 256 LGNSSFRYRVEGTRSRPRHVTAGVPQGSALSPLLFSLYINDIP 128 L N + ++ T S +T G+PQGS L PL F LYIND+P Sbjct: 47 LSNRKQKCQLNSTVSSESKITCGIPQGSILGPLFFLLYINDLP 89 >SB_29864| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 312 Score = 45.6 bits (103), Expect = 4e-05 Identities = 22/55 (40%), Positives = 32/55 (58%) Frame = -1 Query: 286 SFTF*YTRHILGNSSFRYRVEGTRSRPRHVTAGVPQGSALSPLLFSLYINDIPRY 122 SF T ++ G F +++ SR V GVPQGS L P+LF+LY+ND+ + Sbjct: 38 SFLMWVTSYLTGRKQF-VQIDDKSSRLADVCFGVPQGSVLGPVLFNLYVNDLSEH 91 >SB_14288| Best HMM Match : Sorb (HMM E-Value=9.9) Length = 347 Score = 45.6 bits (103), Expect = 4e-05 Identities = 20/43 (46%), Positives = 26/43 (60%) Frame = -1 Query: 256 LGNSSFRYRVEGTRSRPRHVTAGVPQGSALSPLLFSLYINDIP 128 L N + ++ T S +T G+PQGS L PL F LYIND+P Sbjct: 19 LSNRKQKCQLNSTVSSESKITCGIPQGSILGPLFFLLYINDLP 61 >SB_63| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 680 Score = 45.6 bits (103), Expect = 4e-05 Identities = 20/43 (46%), Positives = 26/43 (60%) Frame = -1 Query: 256 LGNSSFRYRVEGTRSRPRHVTAGVPQGSALSPLLFSLYINDIP 128 L N + ++ T S +T G+PQGS L PL F LYIND+P Sbjct: 352 LSNRKQKCQLNSTVSSESKITCGIPQGSILGPLFFLLYINDLP 394 >SB_59792| Best HMM Match : RVT_1 (HMM E-Value=4.2039e-45) Length = 565 Score = 45.2 bits (102), Expect = 5e-05 Identities = 19/34 (55%), Positives = 25/34 (73%) Frame = -1 Query: 229 VEGTRSRPRHVTAGVPQGSALSPLLFSLYINDIP 128 +EG S VT+GVPQG+ L PLLF L++ND+P Sbjct: 247 LEGATSSQCSVTSGVPQGTVLGPLLFLLFVNDLP 280 >SB_51388| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 670 Score = 45.2 bits (102), Expect = 5e-05 Identities = 19/34 (55%), Positives = 25/34 (73%) Frame = -1 Query: 229 VEGTRSRPRHVTAGVPQGSALSPLLFSLYINDIP 128 +EG S VT+GVPQG+ L PLLF L++ND+P Sbjct: 247 LEGATSSQCSVTSGVPQGTVLGPLLFLLFVNDLP 280 >SB_42960| Best HMM Match : RVT_1 (HMM E-Value=2.38221e-44) Length = 455 Score = 45.2 bits (102), Expect = 5e-05 Identities = 19/34 (55%), Positives = 25/34 (73%) Frame = -1 Query: 229 VEGTRSRPRHVTAGVPQGSALSPLLFSLYINDIP 128 +EG S VT+GVPQG+ L PLLF L++ND+P Sbjct: 137 LEGATSSQCSVTSGVPQGTVLGPLLFLLFVNDLP 170 >SB_35551| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 375 Score = 45.2 bits (102), Expect = 5e-05 Identities = 19/34 (55%), Positives = 25/34 (73%) Frame = -1 Query: 229 VEGTRSRPRHVTAGVPQGSALSPLLFSLYINDIP 128 + G S + +TAGVPQGS L PL+F L+IND+P Sbjct: 56 ISGQLSDSQPITAGVPQGSILGPLMFILFINDLP 89 >SB_33817| Best HMM Match : RVT_1 (HMM E-Value=0.1) Length = 291 Score = 45.2 bits (102), Expect = 5e-05 Identities = 19/34 (55%), Positives = 25/34 (73%) Frame = -1 Query: 229 VEGTRSRPRHVTAGVPQGSALSPLLFSLYINDIP 128 + G S + +TAGVPQGS L PL+F L+IND+P Sbjct: 221 ISGQLSDSQPITAGVPQGSILGPLMFILFINDLP 254 >SB_31168| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 279 Score = 45.2 bits (102), Expect = 5e-05 Identities = 19/34 (55%), Positives = 25/34 (73%) Frame = -1 Query: 229 VEGTRSRPRHVTAGVPQGSALSPLLFSLYINDIP 128 + G S + +TAGVPQGS L PL+F L+IND+P Sbjct: 221 ISGQLSDSQPITAGVPQGSILGPLMFILFINDLP 254 >SB_30009| Best HMM Match : RVT_1 (HMM E-Value=1.2e-18) Length = 552 Score = 45.2 bits (102), Expect = 5e-05 Identities = 19/34 (55%), Positives = 25/34 (73%) Frame = -1 Query: 229 VEGTRSRPRHVTAGVPQGSALSPLLFSLYINDIP 128 + G S + +TAGVPQGS L PL+F L+IND+P Sbjct: 258 ISGQLSYSQPITAGVPQGSILGPLMFILFINDLP 291 >SB_27537| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 396 Score = 45.2 bits (102), Expect = 5e-05 Identities = 19/34 (55%), Positives = 25/34 (73%) Frame = -1 Query: 229 VEGTRSRPRHVTAGVPQGSALSPLLFSLYINDIP 128 +EG S VT+GVPQG+ L PLLF L++ND+P Sbjct: 78 LEGATSSQCSVTSGVPQGTVLGPLLFLLFVNDLP 111 >SB_17181| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 668 Score = 45.2 bits (102), Expect = 5e-05 Identities = 19/34 (55%), Positives = 25/34 (73%) Frame = -1 Query: 229 VEGTRSRPRHVTAGVPQGSALSPLLFSLYINDIP 128 +EG S VT+GVPQG+ L PLLF L++ND+P Sbjct: 350 LEGATSSQCSVTSGVPQGTVLGPLLFLLFVNDLP 383 >SB_11072| Best HMM Match : SH2 (HMM E-Value=6.4) Length = 228 Score = 45.2 bits (102), Expect = 5e-05 Identities = 19/34 (55%), Positives = 25/34 (73%) Frame = -1 Query: 229 VEGTRSRPRHVTAGVPQGSALSPLLFSLYINDIP 128 + G S + +TAGVPQGS L PL+F L+IND+P Sbjct: 9 ISGQLSDSQPITAGVPQGSILGPLMFILFINDLP 42 >SB_9950| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 212 Score = 45.2 bits (102), Expect = 5e-05 Identities = 19/34 (55%), Positives = 25/34 (73%) Frame = -1 Query: 229 VEGTRSRPRHVTAGVPQGSALSPLLFSLYINDIP 128 + G S + +TAGVPQGS L PL+F L+IND+P Sbjct: 142 ISGQLSDSQPITAGVPQGSILGPLMFILFINDLP 175 >SB_7414| Best HMM Match : SH2 (HMM E-Value=6.4) Length = 323 Score = 45.2 bits (102), Expect = 5e-05 Identities = 19/34 (55%), Positives = 25/34 (73%) Frame = -1 Query: 229 VEGTRSRPRHVTAGVPQGSALSPLLFSLYINDIP 128 + G S + +TAGVPQGS L PL+F L+IND+P Sbjct: 35 ISGQLSDSQPITAGVPQGSILGPLMFILFINDLP 68 >SB_7292| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 1126 Score = 45.2 bits (102), Expect = 5e-05 Identities = 19/34 (55%), Positives = 25/34 (73%) Frame = -1 Query: 229 VEGTRSRPRHVTAGVPQGSALSPLLFSLYINDIP 128 +EG S VT+GVPQG+ L PLLF L++ND+P Sbjct: 808 LEGATSSQCSVTSGVPQGTVLGPLLFLLFVNDLP 841 >SB_3142| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2209 Score = 45.2 bits (102), Expect = 5e-05 Identities = 22/43 (51%), Positives = 26/43 (60%) Frame = -1 Query: 256 LGNSSFRYRVEGTRSRPRHVTAGVPQGSALSPLLFSLYINDIP 128 L N R V G S VT+GVPQGS L P++F LY ND+P Sbjct: 1675 LSNRRQRVIVLGCTSSEASVTSGVPQGSLLGPIIFLLYANDLP 1717 >SB_2227| Best HMM Match : RVT_1 (HMM E-Value=0.1) Length = 377 Score = 45.2 bits (102), Expect = 5e-05 Identities = 19/34 (55%), Positives = 25/34 (73%) Frame = -1 Query: 229 VEGTRSRPRHVTAGVPQGSALSPLLFSLYINDIP 128 + G S + +TAGVPQGS L PL+F L+IND+P Sbjct: 307 ISGQLSDSQPITAGVPQGSILGPLMFILFINDLP 340 >SB_58023| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 789 Score = 45.2 bits (102), Expect = 5e-05 Identities = 19/34 (55%), Positives = 25/34 (73%) Frame = -1 Query: 229 VEGTRSRPRHVTAGVPQGSALSPLLFSLYINDIP 128 + G S + +TAGVPQGS L PL+F L+IND+P Sbjct: 635 ISGQLSDSQPITAGVPQGSILGPLMFILFINDLP 668 >SB_48125| Best HMM Match : RVT_1 (HMM E-Value=8.4e-38) Length = 453 Score = 45.2 bits (102), Expect = 5e-05 Identities = 20/41 (48%), Positives = 27/41 (65%) Frame = -1 Query: 250 NSSFRYRVEGTRSRPRHVTAGVPQGSALSPLLFSLYINDIP 128 N + R V + S P+ +T G+PQ + L PLLF LYIND+P Sbjct: 189 NRTQRCSVNNSLSGPKFLTCGIPQRTILGPLLFLLYINDLP 229 >SB_45340| Best HMM Match : RVT_1 (HMM E-Value=1.2e-15) Length = 447 Score = 45.2 bits (102), Expect = 5e-05 Identities = 19/34 (55%), Positives = 25/34 (73%) Frame = -1 Query: 229 VEGTRSRPRHVTAGVPQGSALSPLLFSLYINDIP 128 +EG S VT+GVPQG+ L PLLF L++ND+P Sbjct: 129 LEGATSSQCSVTSGVPQGTVLGPLLFLLFVNDLP 162 >SB_45005| Best HMM Match : RVT_1 (HMM E-Value=6.6e-32) Length = 871 Score = 45.2 bits (102), Expect = 5e-05 Identities = 20/41 (48%), Positives = 27/41 (65%) Frame = -1 Query: 250 NSSFRYRVEGTRSRPRHVTAGVPQGSALSPLLFSLYINDIP 128 N + R V + S P+ +T G+PQ + L PLLF LYIND+P Sbjct: 548 NRTQRCSVNNSLSGPKFLTCGIPQRTILGPLLFLLYINDLP 588 >SB_39667| Best HMM Match : rve (HMM E-Value=9e-32) Length = 1845 Score = 45.2 bits (102), Expect = 5e-05 Identities = 22/43 (51%), Positives = 26/43 (60%) Frame = -1 Query: 256 LGNSSFRYRVEGTRSRPRHVTAGVPQGSALSPLLFSLYINDIP 128 L N R V G S VT+GVPQGS L P++F LY ND+P Sbjct: 1626 LSNRRQRVIVLGCTSSEASVTSGVPQGSLLGPIIFLLYANDLP 1668 >SB_39321| Best HMM Match : RVT_1 (HMM E-Value=4.5e-39) Length = 900 Score = 45.2 bits (102), Expect = 5e-05 Identities = 19/34 (55%), Positives = 25/34 (73%) Frame = -1 Query: 229 VEGTRSRPRHVTAGVPQGSALSPLLFSLYINDIP 128 +EG S VT+GVPQG+ L PLLF L++ND+P Sbjct: 582 LEGATSSQCSVTSGVPQGTVLGPLLFLLFVNDLP 615 >SB_38334| Best HMM Match : RVT_1 (HMM E-Value=5.60519e-45) Length = 435 Score = 45.2 bits (102), Expect = 5e-05 Identities = 19/34 (55%), Positives = 25/34 (73%) Frame = -1 Query: 229 VEGTRSRPRHVTAGVPQGSALSPLLFSLYINDIP 128 +EG S VT+GVPQG+ L PLLF L++ND+P Sbjct: 247 LEGATSSQCSVTSGVPQGTVLGPLLFLLFVNDLP 280 >SB_33045| Best HMM Match : RVT_1 (HMM E-Value=3.4e-18) Length = 1061 Score = 45.2 bits (102), Expect = 5e-05 Identities = 19/34 (55%), Positives = 25/34 (73%) Frame = -1 Query: 229 VEGTRSRPRHVTAGVPQGSALSPLLFSLYINDIP 128 +EG S VT+GVPQG+ L PLLF L++ND+P Sbjct: 743 LEGATSSQCSVTSGVPQGTVLGPLLFLLFVNDLP 776 >SB_27764| Best HMM Match : RVT_1 (HMM E-Value=3.99931e-42) Length = 715 Score = 45.2 bits (102), Expect = 5e-05 Identities = 21/39 (53%), Positives = 26/39 (66%) Frame = -1 Query: 238 RYRVEGTRSRPRHVTAGVPQGSALSPLLFSLYINDIPRY 122 R ++G S VT+GVPQGS L PLLF +Y ND+P Y Sbjct: 606 RVVLDGASSSWLPVTSGVPQGSILGPLLFLVYANDMPNY 644 >SB_25508| Best HMM Match : RVT_1 (HMM E-Value=6e-14) Length = 832 Score = 45.2 bits (102), Expect = 5e-05 Identities = 19/34 (55%), Positives = 25/34 (73%) Frame = -1 Query: 229 VEGTRSRPRHVTAGVPQGSALSPLLFSLYINDIP 128 +EG S VT+GVPQG+ L PLLF L++ND+P Sbjct: 514 LEGATSSQCSVTSGVPQGTVLGPLLFLLFVNDLP 547 >SB_25299| Best HMM Match : RVT_1 (HMM E-Value=1.1e-23) Length = 407 Score = 45.2 bits (102), Expect = 5e-05 Identities = 19/34 (55%), Positives = 25/34 (73%) Frame = -1 Query: 229 VEGTRSRPRHVTAGVPQGSALSPLLFSLYINDIP 128 + G S + +TAGVPQGS L PL+F L+IND+P Sbjct: 221 ISGQLSDSQPITAGVPQGSILGPLMFILFINDLP 254 >SB_24847| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 913 Score = 45.2 bits (102), Expect = 5e-05 Identities = 19/34 (55%), Positives = 25/34 (73%) Frame = -1 Query: 229 VEGTRSRPRHVTAGVPQGSALSPLLFSLYINDIP 128 +EG S VT+GVPQG+ L PLLF L++ND+P Sbjct: 805 LEGATSSQCSVTSGVPQGTVLGPLLFLLFVNDLP 838 >SB_24694| Best HMM Match : RVT_1 (HMM E-Value=0.99) Length = 309 Score = 45.2 bits (102), Expect = 5e-05 Identities = 19/34 (55%), Positives = 25/34 (73%) Frame = -1 Query: 229 VEGTRSRPRHVTAGVPQGSALSPLLFSLYINDIP 128 + G S + +TAGVPQGS L PL+F L+IND+P Sbjct: 56 ISGQLSDSQPITAGVPQGSILGPLMFILFINDLP 89 >SB_39712| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 230 Score = 44.8 bits (101), Expect = 7e-05 Identities = 23/48 (47%), Positives = 31/48 (64%) Frame = -1 Query: 271 YTRHILGNSSFRYRVEGTRSRPRHVTAGVPQGSALSPLLFSLYINDIP 128 +T +I N S R + G S + VT+GVPQGS L P+LF L+ ND+P Sbjct: 19 FTSYIT-NRSQRVAIPGGVSTCQPVTSGVPQGSILGPILFVLFANDLP 65 >SB_35875| Best HMM Match : RVT_1 (HMM E-Value=5.2e-24) Length = 1423 Score = 44.8 bits (101), Expect = 7e-05 Identities = 23/48 (47%), Positives = 31/48 (64%) Frame = -1 Query: 271 YTRHILGNSSFRYRVEGTRSRPRHVTAGVPQGSALSPLLFSLYINDIP 128 +T +I N S R + G S + VT+GVPQGS L P+LF L+ ND+P Sbjct: 1052 FTSYIT-NRSQRVAIPGGVSTCQPVTSGVPQGSILGPILFVLFANDLP 1098 >SB_35814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 953 Score = 44.8 bits (101), Expect = 7e-05 Identities = 23/48 (47%), Positives = 31/48 (64%) Frame = -1 Query: 271 YTRHILGNSSFRYRVEGTRSRPRHVTAGVPQGSALSPLLFSLYINDIP 128 +T +I N S R + G S + VT+GVPQGS L P+LF L+ ND+P Sbjct: 664 FTSYIT-NRSQRVAIPGGVSTCQPVTSGVPQGSILGPILFVLFANDLP 710 >SB_1758| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 359 Score = 44.8 bits (101), Expect = 7e-05 Identities = 21/47 (44%), Positives = 28/47 (59%) Frame = -1 Query: 271 YTRHILGNSSFRYRVEGTRSRPRHVTAGVPQGSALSPLLFSLYINDI 131 + + + N V GT S + V +GVPQGS L P+LF L+INDI Sbjct: 201 WVKAFVSNRKQSVSVNGTVSSSKSVVSGVPQGSVLGPVLFLLFINDI 247 >SB_53026| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 201 Score = 44.8 bits (101), Expect = 7e-05 Identities = 19/36 (52%), Positives = 27/36 (75%) Frame = -1 Query: 238 RYRVEGTRSRPRHVTAGVPQGSALSPLLFSLYINDI 131 R V+G S+P VT+GVP+G+ L PL+F L+IND+ Sbjct: 4 RVVVDGVSSKPVDVTSGVPKGTVLGPLMFLLFINDM 39 >SB_35523| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 1410 Score = 44.8 bits (101), Expect = 7e-05 Identities = 23/48 (47%), Positives = 31/48 (64%) Frame = -1 Query: 271 YTRHILGNSSFRYRVEGTRSRPRHVTAGVPQGSALSPLLFSLYINDIP 128 +T +I N S R + G S + VT+GVPQGS L P+LF L+ ND+P Sbjct: 593 FTSYIT-NRSQRVAIPGGVSTCQPVTSGVPQGSILGPILFVLFANDLP 639 >SB_28024| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 968 Score = 44.8 bits (101), Expect = 7e-05 Identities = 23/48 (47%), Positives = 31/48 (64%) Frame = -1 Query: 271 YTRHILGNSSFRYRVEGTRSRPRHVTAGVPQGSALSPLLFSLYINDIP 128 +T +I N S R + G S + VT+GVPQGS L P+LF L+ ND+P Sbjct: 638 FTSYIT-NRSQRVAIPGGVSTCQPVTSGVPQGSILGPILFVLFANDLP 684 >SB_20293| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1821 Score = 44.8 bits (101), Expect = 7e-05 Identities = 23/48 (47%), Positives = 31/48 (64%) Frame = -1 Query: 271 YTRHILGNSSFRYRVEGTRSRPRHVTAGVPQGSALSPLLFSLYINDIP 128 +T +I N S R + G S + VT+GVPQGS L P+LF L+ ND+P Sbjct: 541 FTSYIT-NRSQRVAIPGGVSTCQPVTSGVPQGSILGPILFVLFANDLP 587 >SB_20057| Best HMM Match : RVT_1 (HMM E-Value=3e-13) Length = 269 Score = 44.8 bits (101), Expect = 7e-05 Identities = 21/42 (50%), Positives = 29/42 (69%) Frame = -1 Query: 256 LGNSSFRYRVEGTRSRPRHVTAGVPQGSALSPLLFSLYINDI 131 L N + R V+G S+P VT+ VPQG+ L PL+F L+IND+ Sbjct: 84 LTNRTQRVVVDGVSSKPVDVTSVVPQGTVLGPLMFLLFINDM 125 >SB_42093| Best HMM Match : RVT_1 (HMM E-Value=2.5e-20) Length = 325 Score = 44.4 bits (100), Expect = 9e-05 Identities = 21/47 (44%), Positives = 28/47 (59%) Frame = -1 Query: 271 YTRHILGNSSFRYRVEGTRSRPRHVTAGVPQGSALSPLLFSLYINDI 131 + + + N V GT S + V +GVPQGS L P+LF L+INDI Sbjct: 88 WIKAFVSNRKQSVSVNGTVSSSKSVVSGVPQGSVLGPVLFLLFINDI 134 >SB_40417| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 681 Score = 44.4 bits (100), Expect = 9e-05 Identities = 21/47 (44%), Positives = 28/47 (59%) Frame = -1 Query: 271 YTRHILGNSSFRYRVEGTRSRPRHVTAGVPQGSALSPLLFSLYINDI 131 + + + N V GT S + V +GVPQGS L P+LF L+INDI Sbjct: 88 WIKAFVSNRKQSVSVNGTVSSSKSVVSGVPQGSVLGPVLFLLFINDI 134 >SB_33952| Best HMM Match : Lectin_C (HMM E-Value=3.1) Length = 311 Score = 44.4 bits (100), Expect = 9e-05 Identities = 21/47 (44%), Positives = 28/47 (59%) Frame = -1 Query: 271 YTRHILGNSSFRYRVEGTRSRPRHVTAGVPQGSALSPLLFSLYINDI 131 + + + N V GT S + V +GVPQGS L P+LF L+INDI Sbjct: 4 WIKAFVSNRKQSVSVNGTVSSSKSVVSGVPQGSVLGPVLFLLFINDI 50 >SB_32252| Best HMM Match : RVT_1 (HMM E-Value=9.2e-21) Length = 1033 Score = 44.4 bits (100), Expect = 9e-05 Identities = 23/46 (50%), Positives = 28/46 (60%) Frame = -1 Query: 265 RHILGNSSFRYRVEGTRSRPRHVTAGVPQGSALSPLLFSLYINDIP 128 R L + + R + +S R VT GVPQGS L PLLF YIND+P Sbjct: 248 RSYLCHRTQRTVIGDCQSDLRKVTVGVPQGSVLGPLLFLAYINDLP 293 >SB_28572| Best HMM Match : RVT_1 (HMM E-Value=2e-20) Length = 388 Score = 44.4 bits (100), Expect = 9e-05 Identities = 21/47 (44%), Positives = 28/47 (59%) Frame = -1 Query: 271 YTRHILGNSSFRYRVEGTRSRPRHVTAGVPQGSALSPLLFSLYINDI 131 + + + N V GT S + V +GVPQGS L P+LF L+INDI Sbjct: 88 WIKAFVSNRKQSVSVNGTVSSSKSVVSGVPQGSVLGPVLFLLFINDI 134 >SB_26303| Best HMM Match : Fascin (HMM E-Value=4.4) Length = 328 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/43 (44%), Positives = 26/43 (60%) Frame = -1 Query: 256 LGNSSFRYRVEGTRSRPRHVTAGVPQGSALSPLLFSLYINDIP 128 L N ++++ T S +T +PQGS L PL F LYIND+P Sbjct: 19 LSNRKQKHQLNSTVSSESKITCDIPQGSILGPLFFLLYINDLP 61 >SB_19870| Best HMM Match : RVT_1 (HMM E-Value=0.18) Length = 530 Score = 44.4 bits (100), Expect = 9e-05 Identities = 20/36 (55%), Positives = 27/36 (75%) Frame = -1 Query: 238 RYRVEGTRSRPRHVTAGVPQGSALSPLLFSLYINDI 131 R V G++S HVT+GV QG+ L P+LF+L+INDI Sbjct: 122 RVVVYGSKSEWAHVTSGVSQGTVLGPVLFNLFINDI 157 >SB_15993| Best HMM Match : RVT_1 (HMM E-Value=7.2e-12) Length = 769 Score = 44.4 bits (100), Expect = 9e-05 Identities = 21/47 (44%), Positives = 28/47 (59%) Frame = -1 Query: 271 YTRHILGNSSFRYRVEGTRSRPRHVTAGVPQGSALSPLLFSLYINDI 131 + + + N V GT S + V +GVPQGS L P+LF L+INDI Sbjct: 532 WIKAFVSNRKQSVSVNGTVSSSKSVVSGVPQGSVLGPVLFLLFINDI 578 >SB_3473| Best HMM Match : Fascin (HMM E-Value=4.4) Length = 208 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/43 (44%), Positives = 26/43 (60%) Frame = -1 Query: 256 LGNSSFRYRVEGTRSRPRHVTAGVPQGSALSPLLFSLYINDIP 128 L N ++++ T S +T +PQGS L PL F LYIND+P Sbjct: 19 LSNRKQKHQLNSTVSSESKITCDIPQGSILGPLFFLLYINDLP 61 >SB_54752| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 792 Score = 44.4 bits (100), Expect = 9e-05 Identities = 21/39 (53%), Positives = 25/39 (64%) Frame = -1 Query: 238 RYRVEGTRSRPRHVTAGVPQGSALSPLLFSLYINDIPRY 122 R ++G S VT GVPQGS L PLLF +Y ND+P Y Sbjct: 463 RVVLDGVSSTWLPVTLGVPQGSILGPLLFLVYANDMPNY 501 >SB_43973| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3142 Score = 44.4 bits (100), Expect = 9e-05 Identities = 23/42 (54%), Positives = 26/42 (61%) Frame = -1 Query: 256 LGNSSFRYRVEGTRSRPRHVTAGVPQGSALSPLLFSLYINDI 131 L N S V G+ S VT+GVPQGS L P LF L+INDI Sbjct: 954 LHNRSQFVTVNGSHSATCRVTSGVPQGSVLGPTLFLLFINDI 995 >SB_35242| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 229 Score = 44.4 bits (100), Expect = 9e-05 Identities = 21/47 (44%), Positives = 28/47 (59%) Frame = -1 Query: 271 YTRHILGNSSFRYRVEGTRSRPRHVTAGVPQGSALSPLLFSLYINDI 131 + + + N V GT S + V +GVPQGS L P+LF L+INDI Sbjct: 4 WIKAFVSNRKQSVSVNGTVSSSKSVVSGVPQGSVLGPVLFLLFINDI 50 >SB_24162| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 801 Score = 44.4 bits (100), Expect = 9e-05 Identities = 21/47 (44%), Positives = 28/47 (59%) Frame = -1 Query: 271 YTRHILGNSSFRYRVEGTRSRPRHVTAGVPQGSALSPLLFSLYINDI 131 + + + N V GT S + V +GVPQGS L P+LF L+INDI Sbjct: 502 WIKAFVSNRKQSVSVNGTVSSSKSVVSGVPQGSVLGPVLFLLFINDI 548 >SB_11864| Best HMM Match : RVT_1 (HMM E-Value=0.012) Length = 179 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/33 (57%), Positives = 24/33 (72%) Frame = -1 Query: 229 VEGTRSRPRHVTAGVPQGSALSPLLFSLYINDI 131 V+G S P V++GVPQG+ L PL+F YINDI Sbjct: 93 VDGVSSAPISVSSGVPQGTVLGPLMFLFYINDI 125 >SB_11516| Best HMM Match : Lectin_C (HMM E-Value=2.9) Length = 267 Score = 44.4 bits (100), Expect = 9e-05 Identities = 21/47 (44%), Positives = 28/47 (59%) Frame = -1 Query: 271 YTRHILGNSSFRYRVEGTRSRPRHVTAGVPQGSALSPLLFSLYINDI 131 + + + N V GT S + V +GVPQGS L P+LF L+INDI Sbjct: 30 WIKAFVSNRKQSVSVNGTVSSSKSVVSGVPQGSVLGPVLFLLFINDI 76 >SB_11213| Best HMM Match : RVT_1 (HMM E-Value=6.4e-38) Length = 510 Score = 44.4 bits (100), Expect = 9e-05 Identities = 20/36 (55%), Positives = 26/36 (72%) Frame = -1 Query: 238 RYRVEGTRSRPRHVTAGVPQGSALSPLLFSLYINDI 131 R V G +S VT+GVPQG+ L P+LF+L+INDI Sbjct: 227 RVCVNGAKSSWTRVTSGVPQGTVLGPVLFNLFINDI 262 >SB_10781| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 457 Score = 44.4 bits (100), Expect = 9e-05 Identities = 21/47 (44%), Positives = 28/47 (59%) Frame = -1 Query: 271 YTRHILGNSSFRYRVEGTRSRPRHVTAGVPQGSALSPLLFSLYINDI 131 + + + N V GT S + V +GVPQGS L P+LF L+INDI Sbjct: 299 WIKAFVSNRKQSVSVNGTVSSSKSVVSGVPQGSVLGPVLFLLFINDI 345 >SB_10495| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 258 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/43 (44%), Positives = 26/43 (60%) Frame = -1 Query: 256 LGNSSFRYRVEGTRSRPRHVTAGVPQGSALSPLLFSLYINDIP 128 L N ++++ T S +T +PQGS L PL F LYIND+P Sbjct: 19 LSNRKQKHQLNSTVSSESKITCDIPQGSILGPLFFLLYINDLP 61 >SB_3017| Best HMM Match : RVT_1 (HMM E-Value=1.1e-19) Length = 522 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/33 (57%), Positives = 24/33 (72%) Frame = -1 Query: 229 VEGTRSRPRHVTAGVPQGSALSPLLFSLYINDI 131 V+G S P V++GVPQG+ L PL+F YINDI Sbjct: 436 VDGVSSAPISVSSGVPQGTVLGPLMFLFYINDI 468 >SB_57037| Best HMM Match : RVT_1 (HMM E-Value=3.4e-15) Length = 291 Score = 44.0 bits (99), Expect = 1e-04 Identities = 22/42 (52%), Positives = 27/42 (64%) Frame = -1 Query: 256 LGNSSFRYRVEGTRSRPRHVTAGVPQGSALSPLLFSLYINDI 131 L N S V+G +S VT+GVPQG+ L P LF L+INDI Sbjct: 93 LTNRSQFVAVDGAKSNAVPVTSGVPQGTVLGPTLFLLFINDI 134 >SB_56220| Best HMM Match : RVT_1 (HMM E-Value=3.7e-16) Length = 453 Score = 44.0 bits (99), Expect = 1e-04 Identities = 22/42 (52%), Positives = 27/42 (64%) Frame = -1 Query: 256 LGNSSFRYRVEGTRSRPRHVTAGVPQGSALSPLLFSLYINDI 131 L N S V+G +S VT+GVPQG+ L P LF L+INDI Sbjct: 124 LTNRSQFVAVDGAKSNAVPVTSGVPQGTVLGPTLFLLFINDI 165 >SB_47621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 591 Score = 44.0 bits (99), Expect = 1e-04 Identities = 21/33 (63%), Positives = 23/33 (69%) Frame = -1 Query: 229 VEGTRSRPRHVTAGVPQGSALSPLLFSLYINDI 131 V GT S VT+GVPQGS L P LF L+INDI Sbjct: 517 VNGTHSSCTPVTSGVPQGSVLGPALFLLFINDI 549 >SB_34116| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 522 Score = 44.0 bits (99), Expect = 1e-04 Identities = 22/42 (52%), Positives = 27/42 (64%) Frame = -1 Query: 256 LGNSSFRYRVEGTRSRPRHVTAGVPQGSALSPLLFSLYINDI 131 L N S V+G +S VT+GVPQG+ L P LF L+INDI Sbjct: 193 LTNRSQFVAVDGAKSNAVPVTSGVPQGTVLGPTLFLLFINDI 234 >SB_30332| Best HMM Match : RVT_1 (HMM E-Value=2.7e-34) Length = 1683 Score = 44.0 bits (99), Expect = 1e-04 Identities = 22/42 (52%), Positives = 27/42 (64%) Frame = -1 Query: 256 LGNSSFRYRVEGTRSRPRHVTAGVPQGSALSPLLFSLYINDI 131 L N S V+G +S VT+GVPQG+ L P LF L+INDI Sbjct: 1011 LTNRSQFVAVDGAKSNAVPVTSGVPQGTVLGPTLFLLFINDI 1052 Score = 37.5 bits (83), Expect = 0.010 Identities = 16/23 (69%), Positives = 19/23 (82%) Frame = -1 Query: 199 VTAGVPQGSALSPLLFSLYINDI 131 VT+GVPQG+ L P LF LYI+DI Sbjct: 1222 VTSGVPQGTVLGPTLFLLYISDI 1244 >SB_28979| Best HMM Match : RVT_1 (HMM E-Value=1.6e-40) Length = 892 Score = 44.0 bits (99), Expect = 1e-04 Identities = 22/42 (52%), Positives = 27/42 (64%) Frame = -1 Query: 256 LGNSSFRYRVEGTRSRPRHVTAGVPQGSALSPLLFSLYINDI 131 L N S V+G +S VT+GVPQG+ L P LF L+INDI Sbjct: 563 LTNRSQFVAVDGAKSNAVPVTSGVPQGTVLGPTLFLLFINDI 604 >SB_59500| Best HMM Match : RVT_1 (HMM E-Value=0.015) Length = 224 Score = 44.0 bits (99), Expect = 1e-04 Identities = 22/42 (52%), Positives = 27/42 (64%) Frame = -1 Query: 256 LGNSSFRYRVEGTRSRPRHVTAGVPQGSALSPLLFSLYINDI 131 L N S V+G +S VT+GVPQG+ L P LF L+INDI Sbjct: 143 LTNRSQFVAVDGAKSNAVPVTSGVPQGTVLGPTLFLLFINDI 184 >SB_54400| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 723 Score = 44.0 bits (99), Expect = 1e-04 Identities = 19/33 (57%), Positives = 25/33 (75%) Frame = -1 Query: 229 VEGTRSRPRHVTAGVPQGSALSPLLFSLYINDI 131 V G +S VT+GVPQG+ L P+LF+L+INDI Sbjct: 596 VNGAKSSWTRVTSGVPQGTVLGPVLFNLFINDI 628 >SB_50676| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 838 Score = 44.0 bits (99), Expect = 1e-04 Identities = 22/42 (52%), Positives = 27/42 (64%) Frame = -1 Query: 256 LGNSSFRYRVEGTRSRPRHVTAGVPQGSALSPLLFSLYINDI 131 L N S V+G +S VT+GVPQG+ L P LF L+INDI Sbjct: 729 LTNRSQFVAVDGAKSNAVPVTSGVPQGTVLGPTLFLLFINDI 770 >SB_28404| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 292 Score = 44.0 bits (99), Expect = 1e-04 Identities = 21/33 (63%), Positives = 23/33 (69%) Frame = -1 Query: 229 VEGTRSRPRHVTAGVPQGSALSPLLFSLYINDI 131 V GT S VT+GVPQGS L P LF L+INDI Sbjct: 88 VNGTHSSCTPVTSGVPQGSVLGPALFLLFINDI 120 Score = 29.5 bits (63), Expect = 2.7 Identities = 15/36 (41%), Positives = 21/36 (58%) Frame = -2 Query: 114 THLALFADDTAIYYSCRKKALLHRRLQTAATTMGQW 7 +HL LFADDT +Y + R A H+ LQ + +W Sbjct: 126 SHLRLFADDTVVYRNIR-SADDHQVLQQDLDNLTKW 160 >SB_25497| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 372 Score = 44.0 bits (99), Expect = 1e-04 Identities = 21/33 (63%), Positives = 23/33 (69%) Frame = -1 Query: 229 VEGTRSRPRHVTAGVPQGSALSPLLFSLYINDI 131 V GT S VT+GVPQGS L P LF L+INDI Sbjct: 44 VNGTHSSCTPVTSGVPQGSVLGPALFLLFINDI 76 Score = 29.5 bits (63), Expect = 2.7 Identities = 15/36 (41%), Positives = 21/36 (58%) Frame = -2 Query: 114 THLALFADDTAIYYSCRKKALLHRRLQTAATTMGQW 7 +HL LFADDT +Y + R A H+ LQ + +W Sbjct: 82 SHLRLFADDTVVYRNIR-SADDHQVLQQDLDNLTKW 116 >SB_21992| Best HMM Match : LRR_1 (HMM E-Value=3.2e-07) Length = 534 Score = 44.0 bits (99), Expect = 1e-04 Identities = 19/33 (57%), Positives = 25/33 (75%) Frame = -1 Query: 229 VEGTRSRPRHVTAGVPQGSALSPLLFSLYINDI 131 V G +S VT+GVPQG+ L P+LF+L+INDI Sbjct: 428 VNGAKSSWTRVTSGVPQGTVLGPVLFNLFINDI 460 >SB_11067| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 1176 Score = 44.0 bits (99), Expect = 1e-04 Identities = 22/42 (52%), Positives = 27/42 (64%) Frame = -1 Query: 256 LGNSSFRYRVEGTRSRPRHVTAGVPQGSALSPLLFSLYINDI 131 L N S V+G +S VT+GVPQG+ L P LF L+INDI Sbjct: 899 LTNRSQFVAVDGAKSNAVPVTSGVPQGTVLGPTLFLLFINDI 940 >SB_7440| Best HMM Match : fn3 (HMM E-Value=0.35) Length = 602 Score = 44.0 bits (99), Expect = 1e-04 Identities = 21/36 (58%), Positives = 26/36 (72%) Frame = -1 Query: 238 RYRVEGTRSRPRHVTAGVPQGSALSPLLFSLYINDI 131 R V G +S V +GVPQG+ LSP+LFSL+INDI Sbjct: 527 RVVVNGAKSNWLTVKSGVPQGTVLSPVLFSLFINDI 562 >SB_5024| Best HMM Match : rve (HMM E-Value=6.3e-36) Length = 1677 Score = 44.0 bits (99), Expect = 1e-04 Identities = 22/42 (52%), Positives = 27/42 (64%) Frame = -1 Query: 256 LGNSSFRYRVEGTRSRPRHVTAGVPQGSALSPLLFSLYINDI 131 L N S V+G +S VT+GVPQG+ L P LF L+INDI Sbjct: 1319 LTNRSQFVAVDGAKSNAVPVTSGVPQGTVLGPTLFLLFINDI 1360 >SB_2458| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 458 Score = 44.0 bits (99), Expect = 1e-04 Identities = 21/33 (63%), Positives = 23/33 (69%) Frame = -1 Query: 229 VEGTRSRPRHVTAGVPQGSALSPLLFSLYINDI 131 V GT S VT+GVPQGS L P LF L+INDI Sbjct: 234 VNGTHSSCTPVTSGVPQGSVLGPALFLLFINDI 266 Score = 29.5 bits (63), Expect = 2.7 Identities = 15/36 (41%), Positives = 21/36 (58%) Frame = -2 Query: 114 THLALFADDTAIYYSCRKKALLHRRLQTAATTMGQW 7 +HL LFADDT +Y + R A H+ LQ + +W Sbjct: 272 SHLRLFADDTVVYRNIR-SADDHQVLQQDLDNLTKW 306 >SB_53252| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 366 Score = 43.6 bits (98), Expect = 2e-04 Identities = 22/48 (45%), Positives = 31/48 (64%) Frame = -1 Query: 271 YTRHILGNSSFRYRVEGTRSRPRHVTAGVPQGSALSPLLFSLYINDIP 128 +T +I N S R + G + + VT+GVPQGS L P+LF L+ ND+P Sbjct: 150 FTSYIT-NRSQRVAIPGGVATCQPVTSGVPQGSILGPILFVLFANDLP 196 >SB_49549| Best HMM Match : RVT_1 (HMM E-Value=3.6e-11) Length = 520 Score = 43.6 bits (98), Expect = 2e-04 Identities = 18/34 (52%), Positives = 24/34 (70%) Frame = -1 Query: 229 VEGTRSRPRHVTAGVPQGSALSPLLFSLYINDIP 128 + G S + +T GVPQGS L PL+F L+IND+P Sbjct: 375 ISGQLSDSQPITVGVPQGSILGPLMFILFINDLP 408 >SB_32197| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 43.6 bits (98), Expect = 2e-04 Identities = 21/47 (44%), Positives = 27/47 (57%) Frame = -1 Query: 271 YTRHILGNSSFRYRVEGTRSRPRHVTAGVPQGSALSPLLFSLYINDI 131 + + + N V GT S + V GVPQGS L P+LF L+INDI Sbjct: 402 WIKAFVSNRKQSVSVNGTVSSSKSVVPGVPQGSVLGPVLFLLFINDI 448 >SB_19117| Best HMM Match : XPG_N (HMM E-Value=1.8) Length = 361 Score = 43.6 bits (98), Expect = 2e-04 Identities = 17/26 (65%), Positives = 22/26 (84%) Frame = -1 Query: 205 RHVTAGVPQGSALSPLLFSLYINDIP 128 + VT+GVPQG+ L PLLF LY+ND+P Sbjct: 54 KKVTSGVPQGTVLGPLLFLLYVNDLP 79 >SB_53855| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 43.6 bits (98), Expect = 2e-04 Identities = 21/54 (38%), Positives = 30/54 (55%) Frame = -1 Query: 271 YTRHILGNSSFRYRVEGTRSRPRHVTAGVPQGSALSPLLFSLYINDIPRYXGDP 110 + ++ G F ++G S + GVPQGS L PLLF L+IND+P + P Sbjct: 41 FESYLRGRRQF-VSIDGVDSNLSVIQHGVPQGSILGPLLFVLFINDLPFHISSP 93 >SB_52988| Best HMM Match : RVT_1 (HMM E-Value=2.5) Length = 277 Score = 43.6 bits (98), Expect = 2e-04 Identities = 18/34 (52%), Positives = 25/34 (73%) Frame = -1 Query: 229 VEGTRSRPRHVTAGVPQGSALSPLLFSLYINDIP 128 + G S + +TAGVP+GS L PL+F L+IND+P Sbjct: 56 ISGQLSDSQPITAGVPRGSILGPLMFILFINDLP 89 >SB_37732| Best HMM Match : RVT_1 (HMM E-Value=2e-23) Length = 951 Score = 43.6 bits (98), Expect = 2e-04 Identities = 20/34 (58%), Positives = 24/34 (70%) Frame = -1 Query: 229 VEGTRSRPRHVTAGVPQGSALSPLLFSLYINDIP 128 V+ S P VT+GVPQ S + PLLF LYIND+P Sbjct: 639 VDRGHSSPAIVTSGVPQWSVVGPLLFLLYINDLP 672 >SB_36813| Best HMM Match : RVT_1 (HMM E-Value=1.4e-14) Length = 382 Score = 43.6 bits (98), Expect = 2e-04 Identities = 19/43 (44%), Positives = 25/43 (58%) Frame = -1 Query: 256 LGNSSFRYRVEGTRSRPRHVTAGVPQGSALSPLLFSLYINDIP 128 L N + ++ T S +T G+PQGS L P F LYIND+P Sbjct: 89 LSNRKQKCQINSTVSSESKITCGIPQGSILGPPFFLLYINDLP 131 >SB_33259| Best HMM Match : RVT_1 (HMM E-Value=4.3e-12) Length = 303 Score = 43.6 bits (98), Expect = 2e-04 Identities = 22/48 (45%), Positives = 31/48 (64%) Frame = -1 Query: 271 YTRHILGNSSFRYRVEGTRSRPRHVTAGVPQGSALSPLLFSLYINDIP 128 +T +I N S R + G + + VT+GVPQGS L P+LF L+ ND+P Sbjct: 87 FTSYIT-NRSQRVAIPGGVATCQPVTSGVPQGSILGPILFVLFANDLP 133 >SB_24072| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 822 Score = 43.6 bits (98), Expect = 2e-04 Identities = 18/26 (69%), Positives = 21/26 (80%) Frame = -1 Query: 199 VTAGVPQGSALSPLLFSLYINDIPRY 122 VT+GVPQGS L PLLF +Y ND+P Y Sbjct: 613 VTSGVPQGSILGPLLFLVYANDMPNY 638 >SB_19684| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 617 Score = 43.6 bits (98), Expect = 2e-04 Identities = 22/48 (45%), Positives = 31/48 (64%) Frame = -1 Query: 271 YTRHILGNSSFRYRVEGTRSRPRHVTAGVPQGSALSPLLFSLYINDIP 128 +T +I N S R + G + + VT+GVPQGS L P+LF L+ ND+P Sbjct: 401 FTSYIT-NRSQRVAIPGGVATCQPVTSGVPQGSILGPILFVLFANDLP 447 >SB_5957| Best HMM Match : Chitin_synth_1 (HMM E-Value=9) Length = 416 Score = 43.6 bits (98), Expect = 2e-04 Identities = 20/36 (55%), Positives = 26/36 (72%) Frame = -1 Query: 238 RYRVEGTRSRPRHVTAGVPQGSALSPLLFSLYINDI 131 R V G +S VT+GVPQG+ L P+LF+L+INDI Sbjct: 359 RVCVHGAKSSWTWVTSGVPQGTVLGPVLFNLFINDI 394 >SB_39979| Best HMM Match : RVT_1 (HMM E-Value=4.6e-12) Length = 792 Score = 43.2 bits (97), Expect = 2e-04 Identities = 19/41 (46%), Positives = 25/41 (60%) Frame = -1 Query: 229 VEGTRSRPRHVTAGVPQGSALSPLLFSLYINDIPRYXGDPS 107 + G RS R V GVPQGS L P+L L++ND+P + S Sbjct: 630 LNGERSESRIVKQGVPQGSVLGPILLFLFVNDMPLHLSQSS 670 Score = 37.9 bits (84), Expect = 0.008 Identities = 16/33 (48%), Positives = 23/33 (69%) Frame = -1 Query: 232 RVEGTRSRPRHVTAGVPQGSALSPLLFSLYIND 134 ++ ++S ++ GVPQGS L P+LF LYIND Sbjct: 383 QIGSSKSSLSSISYGVPQGSVLGPVLFLLYIND 415 >SB_39386| Best HMM Match : RVT_1 (HMM E-Value=7.1e-28) Length = 1239 Score = 43.2 bits (97), Expect = 2e-04 Identities = 22/55 (40%), Positives = 31/55 (56%) Frame = -1 Query: 286 SFTF*YTRHILGNSSFRYRVEGTRSRPRHVTAGVPQGSALSPLLFSLYINDIPRY 122 SF T ++ G F +++ SR GVPQGS L PLLF+LY+ND+ + Sbjct: 544 SFLMWATSYLTGRKQF-VQIDDKSSRLADGYFGVPQGSVLGPLLFNLYVNDLSEH 597 >SB_31085| Best HMM Match : RVT_1 (HMM E-Value=0.0094) Length = 270 Score = 43.2 bits (97), Expect = 2e-04 Identities = 19/36 (52%), Positives = 26/36 (72%) Frame = -1 Query: 238 RYRVEGTRSRPRHVTAGVPQGSALSPLLFSLYINDI 131 R V G +S VT+GVPQG+ L P+LF+++INDI Sbjct: 77 RVCVNGAKSSWTRVTSGVPQGTVLGPVLFNVFINDI 112 >SB_27867| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 208 Score = 43.2 bits (97), Expect = 2e-04 Identities = 19/43 (44%), Positives = 25/43 (58%) Frame = -1 Query: 256 LGNSSFRYRVEGTRSRPRHVTAGVPQGSALSPLLFSLYINDIP 128 L N + ++ T S +T G+PQ S L PL F LYIND+P Sbjct: 19 LSNRKQKCQLNSTVSSESKITCGIPQSSILGPLFFLLYINDLP 61 >SB_907| Best HMM Match : RVT_1 (HMM E-Value=1.3e-27) Length = 681 Score = 43.2 bits (97), Expect = 2e-04 Identities = 19/42 (45%), Positives = 27/42 (64%) Frame = -1 Query: 256 LGNSSFRYRVEGTRSRPRHVTAGVPQGSALSPLLFSLYINDI 131 LGN R V+G ++ + GVPQG+ L P+LFS+ +NDI Sbjct: 565 LGNRKQRVGVDGVSTKFVEIDRGVPQGTVLGPVLFSIMVNDI 606 >SB_798| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 845 Score = 43.2 bits (97), Expect = 2e-04 Identities = 21/56 (37%), Positives = 30/56 (53%) Frame = -1 Query: 271 YTRHILGNSSFRYRVEGTRSRPRHVTAGVPQGSALSPLLFSLYINDIPRYXGDPSG 104 + ++ G F ++G S + GVP GS L PLLF L+IND+P + P G Sbjct: 769 FESYLRGRRQF-VSIDGVDSDLSVIQHGVPSGSILGPLLFVLFINDLPFHISSPKG 823 >SB_30760| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1868 Score = 43.2 bits (97), Expect = 2e-04 Identities = 18/32 (56%), Positives = 22/32 (68%) Frame = -1 Query: 223 GTRSRPRHVTAGVPQGSALSPLLFSLYINDIP 128 G RS + G+PQGS L PLLF +YIND+P Sbjct: 1508 GARSSELTMLCGIPQGSTLGPLLFLIYINDLP 1539 >SB_14841| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 1821 Score = 43.2 bits (97), Expect = 2e-04 Identities = 19/43 (44%), Positives = 25/43 (58%) Frame = -1 Query: 256 LGNSSFRYRVEGTRSRPRHVTAGVPQGSALSPLLFSLYINDIP 128 L N + ++ T S + G+PQGS L PL F LYIND+P Sbjct: 1493 LSNRKQKCQLNSTVSSESKIQCGIPQGSILGPLFFLLYINDLP 1535 >SB_58923| Best HMM Match : RVT_1 (HMM E-Value=0.022) Length = 270 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/34 (52%), Positives = 24/34 (70%) Frame = -1 Query: 229 VEGTRSRPRHVTAGVPQGSALSPLLFSLYINDIP 128 + G S + +TAGVPQ S L PL+F L+IND+P Sbjct: 69 ISGQLSDSQPITAGVPQSSILGPLMFILFINDLP 102 >SB_58171| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 535 Score = 42.7 bits (96), Expect = 3e-04 Identities = 21/54 (38%), Positives = 30/54 (55%) Frame = -1 Query: 271 YTRHILGNSSFRYRVEGTRSRPRHVTAGVPQGSALSPLLFSLYINDIPRYXGDP 110 + ++ G F ++G S + GVPQGS L PLLF L+IND+P + P Sbjct: 446 FESYLRGRRQF-VSIDGVDSDLSVIQHGVPQGSILGPLLFVLFINDLPFHISSP 498 >SB_40620| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/33 (57%), Positives = 24/33 (72%) Frame = -1 Query: 229 VEGTRSRPRHVTAGVPQGSALSPLLFSLYINDI 131 V+G +S VT+GVPQG+ L P LF L+INDI Sbjct: 4 VDGAKSNAVPVTSGVPQGTVLGPTLFLLFINDI 36 >SB_39669| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 566 Score = 42.7 bits (96), Expect = 3e-04 Identities = 21/54 (38%), Positives = 30/54 (55%) Frame = -1 Query: 271 YTRHILGNSSFRYRVEGTRSRPRHVTAGVPQGSALSPLLFSLYINDIPRYXGDP 110 + ++ G F ++G S + GVPQGS L PLLF L+IND+P + P Sbjct: 391 FESYLRGRRQF-VSIDGVDSDLSVIQHGVPQGSILGPLLFVLFINDLPFHISSP 443 >SB_37487| Best HMM Match : RVT_1 (HMM E-Value=0.03) Length = 347 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/33 (57%), Positives = 24/33 (72%) Frame = -1 Query: 229 VEGTRSRPRHVTAGVPQGSALSPLLFSLYINDI 131 V+G +S VT+GVPQG+ L P LF L+INDI Sbjct: 204 VDGAKSNAVPVTSGVPQGTVLGPTLFLLFINDI 236 >SB_36088| Best HMM Match : RVT_1 (HMM E-Value=9e-12) Length = 471 Score = 42.7 bits (96), Expect = 3e-04 Identities = 21/54 (38%), Positives = 30/54 (55%) Frame = -1 Query: 271 YTRHILGNSSFRYRVEGTRSRPRHVTAGVPQGSALSPLLFSLYINDIPRYXGDP 110 + ++ G F ++G S + GVPQGS L PLLF L+IND+P + P Sbjct: 373 FESYLRGRRQF-VSIDGVDSDLSVIQHGVPQGSILGPLLFVLFINDLPFHISSP 425 >SB_33669| Best HMM Match : EMP70 (HMM E-Value=3.9e-11) Length = 809 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/34 (52%), Positives = 24/34 (70%) Frame = -1 Query: 229 VEGTRSRPRHVTAGVPQGSALSPLLFSLYINDIP 128 + G S + +TAGVPQ S L PL+F L+IND+P Sbjct: 281 ISGQLSDSQPITAGVPQSSILGPLMFILFINDLP 314 >SB_27524| Best HMM Match : RVT_1 (HMM E-Value=1.30321e-43) Length = 593 Score = 42.7 bits (96), Expect = 3e-04 Identities = 21/54 (38%), Positives = 30/54 (55%) Frame = -1 Query: 271 YTRHILGNSSFRYRVEGTRSRPRHVTAGVPQGSALSPLLFSLYINDIPRYXGDP 110 + ++ G F ++G S + GVPQGS L PLLF L+IND+P + P Sbjct: 241 FESYLRGRRQF-VSIDGVDSDLSVIQHGVPQGSILGPLLFVLFINDLPFHISSP 293 >SB_24260| Best HMM Match : Rotavirus_VP7 (HMM E-Value=7.7) Length = 319 Score = 42.7 bits (96), Expect = 3e-04 Identities = 21/54 (38%), Positives = 30/54 (55%) Frame = -1 Query: 271 YTRHILGNSSFRYRVEGTRSRPRHVTAGVPQGSALSPLLFSLYINDIPRYXGDP 110 + ++ G F ++G S + GVPQGS L PLLF L+IND+P + P Sbjct: 17 FESYLRGRRQF-VSIDGVDSDLSVIQHGVPQGSILGPLLFVLFINDLPFHISSP 69 >SB_21609| Best HMM Match : Peptidase_M23 (HMM E-Value=5.7) Length = 527 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/42 (45%), Positives = 27/42 (64%) Frame = -1 Query: 256 LGNSSFRYRVEGTRSRPRHVTAGVPQGSALSPLLFSLYINDI 131 LGN R V+G ++ + GVPQG+ L P+LFS+ +NDI Sbjct: 446 LGNRKQRVVVDGVSTKFVEIDRGVPQGTVLGPVLFSIMVNDI 487 >SB_18646| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 42.7 bits (96), Expect = 3e-04 Identities = 20/36 (55%), Positives = 23/36 (63%) Frame = -1 Query: 238 RYRVEGTRSRPRHVTAGVPQGSALSPLLFSLYINDI 131 R + G SR VT GVPQGS + PLLF YIND+ Sbjct: 22 RVVIRGMASRHLPVTPGVPQGSLIGPLLFRTYINDL 57 >SB_17950| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 173 Score = 42.7 bits (96), Expect = 3e-04 Identities = 21/54 (38%), Positives = 30/54 (55%) Frame = -1 Query: 271 YTRHILGNSSFRYRVEGTRSRPRHVTAGVPQGSALSPLLFSLYINDIPRYXGDP 110 + ++ G F ++G S + GVPQGS L PLLF L+IND+P + P Sbjct: 35 FESYLRGRRQF-VSIDGVDSDLSVIQHGVPQGSILGPLLFVLFINDLPFHISSP 87 >SB_7633| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 337 Score = 42.7 bits (96), Expect = 3e-04 Identities = 21/54 (38%), Positives = 30/54 (55%) Frame = -1 Query: 271 YTRHILGNSSFRYRVEGTRSRPRHVTAGVPQGSALSPLLFSLYINDIPRYXGDP 110 + ++ G F ++G S + GVPQGS L PLLF L+IND+P + P Sbjct: 35 FESYLRGRRQF-VSIDGVDSDLSVIQHGVPQGSILGPLLFVLFINDLPFHISSP 87 >SB_53800| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 666 Score = 42.7 bits (96), Expect = 3e-04 Identities = 21/54 (38%), Positives = 30/54 (55%) Frame = -1 Query: 271 YTRHILGNSSFRYRVEGTRSRPRHVTAGVPQGSALSPLLFSLYINDIPRYXGDP 110 + ++ G F ++G S + GVPQGS L PLLF L+IND+P + P Sbjct: 590 FESYLRGRRQF-VSIDGVDSDLSVIQHGVPQGSILGPLLFVLFINDLPFHISSP 642 >SB_51996| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 376 Score = 42.7 bits (96), Expect = 3e-04 Identities = 21/54 (38%), Positives = 30/54 (55%) Frame = -1 Query: 271 YTRHILGNSSFRYRVEGTRSRPRHVTAGVPQGSALSPLLFSLYINDIPRYXGDP 110 + ++ G F ++G S + GVPQGS L PLLF L+IND+P + P Sbjct: 24 FESYLRGRRQF-VSIDGVDSDLSVIQHGVPQGSILGPLLFVLFINDLPFHISSP 76 >SB_41541| Best HMM Match : RVT_1 (HMM E-Value=3.1e-17) Length = 283 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/33 (57%), Positives = 24/33 (72%) Frame = -1 Query: 229 VEGTRSRPRHVTAGVPQGSALSPLLFSLYINDI 131 V+G S P V++GVPQ + L PL+F LYINDI Sbjct: 93 VDGVSSAPISVSSGVPQRTVLGPLMFLLYINDI 125 >SB_41403| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1415 Score = 42.7 bits (96), Expect = 3e-04 Identities = 21/54 (38%), Positives = 30/54 (55%) Frame = -1 Query: 271 YTRHILGNSSFRYRVEGTRSRPRHVTAGVPQGSALSPLLFSLYINDIPRYXGDP 110 + ++ G F ++G S + GVPQGS L PLLF L+IND+P + P Sbjct: 35 FESYLRGRRQF-VSIDGVDSDLSVIQHGVPQGSILGPLLFVLFINDLPFHISSP 87 >SB_41175| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3259 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/42 (45%), Positives = 27/42 (64%) Frame = -1 Query: 256 LGNSSFRYRVEGTRSRPRHVTAGVPQGSALSPLLFSLYINDI 131 LGN R V+G ++ + GVPQG+ L P+LFS+ +NDI Sbjct: 1729 LGNRKQRVVVDGVSTKFVEIDRGVPQGTVLGPVLFSIMVNDI 1770 >SB_38851| Best HMM Match : RVT_1 (HMM E-Value=9.8e-20) Length = 838 Score = 42.7 bits (96), Expect = 3e-04 Identities = 20/37 (54%), Positives = 26/37 (70%) Frame = -1 Query: 238 RYRVEGTRSRPRHVTAGVPQGSALSPLLFSLYINDIP 128 R V G+ S VT+GVPQG+ L P+LF L+IND+P Sbjct: 288 RVVVNGSCSEWSPVTSGVPQGTVLGPVLFLLFINDMP 324 >SB_36163| Best HMM Match : RVT_1 (HMM E-Value=4.2e-11) Length = 258 Score = 42.7 bits (96), Expect = 3e-04 Identities = 21/54 (38%), Positives = 30/54 (55%) Frame = -1 Query: 271 YTRHILGNSSFRYRVEGTRSRPRHVTAGVPQGSALSPLLFSLYINDIPRYXGDP 110 + ++ G F ++G S + GVPQGS L PLLF L+IND+P + P Sbjct: 160 FESYLRGRRQF-VSIDGVDSDLSVIQHGVPQGSILGPLLFVLFINDLPFHISSP 212 >SB_32204| Best HMM Match : wnt (HMM E-Value=8.2e-31) Length = 731 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/42 (45%), Positives = 27/42 (64%) Frame = -1 Query: 256 LGNSSFRYRVEGTRSRPRHVTAGVPQGSALSPLLFSLYINDI 131 LGN R V+G ++ + GVPQG+ L P+LFS+ +NDI Sbjct: 376 LGNRKQRVVVDGVSTKFVEIDRGVPQGTVLGPVLFSIMVNDI 417 >SB_30215| Best HMM Match : RVT_1 (HMM E-Value=2.6e-34) Length = 875 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/42 (45%), Positives = 25/42 (59%) Frame = -1 Query: 256 LGNSSFRYRVEGTRSRPRHVTAGVPQGSALSPLLFSLYINDI 131 L N + ++ T S +T G+PQGS L PL F LYIND+ Sbjct: 302 LSNRKQKCQLNSTVSSESKITCGIPQGSILGPLFFLLYINDL 343 >SB_27268| Best HMM Match : RVT_1 (HMM E-Value=2.24208e-44) Length = 548 Score = 42.7 bits (96), Expect = 3e-04 Identities = 21/54 (38%), Positives = 30/54 (55%) Frame = -1 Query: 271 YTRHILGNSSFRYRVEGTRSRPRHVTAGVPQGSALSPLLFSLYINDIPRYXGDP 110 + ++ G F ++G S + GVPQGS L PLLF L+IND+P + P Sbjct: 373 FESYLRGRRQF-VSIDGVDSDLSVIQHGVPQGSILGPLLFVLFINDLPFHISSP 425 >SB_23276| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/33 (57%), Positives = 24/33 (72%) Frame = -1 Query: 229 VEGTRSRPRHVTAGVPQGSALSPLLFSLYINDI 131 V+G +S VT+GVPQG+ L P LF L+INDI Sbjct: 4 VDGAKSNAVPVTSGVPQGTVLGPTLFLLFINDI 36 >SB_14371| Best HMM Match : RVT_1 (HMM E-Value=2.2e-18) Length = 263 Score = 42.7 bits (96), Expect = 3e-04 Identities = 21/54 (38%), Positives = 30/54 (55%) Frame = -1 Query: 271 YTRHILGNSSFRYRVEGTRSRPRHVTAGVPQGSALSPLLFSLYINDIPRYXGDP 110 + ++ G F ++G S + GVPQGS L PLLF L+IND+P + P Sbjct: 126 FESYLRGRRQF-VSIDGVDSDLSVIQHGVPQGSILGPLLFVLFINDLPFHISSP 178 >SB_7760| Best HMM Match : Peptidase_M23 (HMM E-Value=5.7) Length = 555 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/42 (45%), Positives = 27/42 (64%) Frame = -1 Query: 256 LGNSSFRYRVEGTRSRPRHVTAGVPQGSALSPLLFSLYINDI 131 LGN R V+G ++ + GVPQG+ L P+LFS+ +NDI Sbjct: 474 LGNRKQRVVVDGVSTKFVEIDRGVPQGTVLGPVLFSIMVNDI 515 >SB_7055| Best HMM Match : RVT_1 (HMM E-Value=0.00051) Length = 198 Score = 42.7 bits (96), Expect = 3e-04 Identities = 21/39 (53%), Positives = 25/39 (64%) Frame = -1 Query: 238 RYRVEGTRSRPRHVTAGVPQGSALSPLLFSLYINDIPRY 122 R ++G S VT+GVPQ S L PLLF +Y NDIP Y Sbjct: 78 RVVLDGASSSWLPVTSGVPQVSILGPLLFLVYANDIPNY 116 >SB_2851| Best HMM Match : RVT_1 (HMM E-Value=3.50325e-43) Length = 890 Score = 42.7 bits (96), Expect = 3e-04 Identities = 21/54 (38%), Positives = 30/54 (55%) Frame = -1 Query: 271 YTRHILGNSSFRYRVEGTRSRPRHVTAGVPQGSALSPLLFSLYINDIPRYXGDP 110 + ++ G F ++G S + GVPQGS L PLLF L+IND+P + P Sbjct: 538 FESYLRGRRQF-VSIDGVDSDLSVIQHGVPQGSILGPLLFVLFINDLPFHISSP 590 >SB_26221| Best HMM Match : RVT_1 (HMM E-Value=1.6e-24) Length = 488 Score = 42.3 bits (95), Expect = 4e-04 Identities = 21/45 (46%), Positives = 27/45 (60%) Frame = -1 Query: 262 HILGNSSFRYRVEGTRSRPRHVTAGVPQGSALSPLLFSLYINDIP 128 H L + + V+G S P V + VPQGS L PL F +YIND+P Sbjct: 219 HYLSDRTQCTVVQGATSSPLPVLSSVPQGSLLCPLHFLVYINDLP 263 >SB_8605| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 284 Score = 42.3 bits (95), Expect = 4e-04 Identities = 19/43 (44%), Positives = 25/43 (58%) Frame = -1 Query: 256 LGNSSFRYRVEGTRSRPRHVTAGVPQGSALSPLLFSLYINDIP 128 L N + ++ T S +T G+PQGS L L F LYIND+P Sbjct: 128 LSNRKQKCQLNSTVSSESKITCGIPQGSILGQLFFLLYINDLP 170 >SB_3943| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1457 Score = 42.3 bits (95), Expect = 4e-04 Identities = 19/43 (44%), Positives = 25/43 (58%) Frame = -1 Query: 256 LGNSSFRYRVEGTRSRPRHVTAGVPQGSALSPLLFSLYINDIP 128 L N + ++ T S +T G+PQGS L L F LYIND+P Sbjct: 809 LSNRKQKCQLNSTVSSESKITCGIPQGSILGQLFFLLYINDLP 851 >SB_40881| Best HMM Match : RVT_1 (HMM E-Value=2.9e-21) Length = 426 Score = 41.9 bits (94), Expect = 5e-04 Identities = 21/55 (38%), Positives = 31/55 (56%) Frame = -1 Query: 286 SFTF*YTRHILGNSSFRYRVEGTRSRPRHVTAGVPQGSALSPLLFSLYINDIPRY 122 SF T ++ G F +++ SR V GVPQGS L +LF+LY+ND+ + Sbjct: 78 SFLMWVTSYLTGRKQF-VQIDDKSSRLADVCLGVPQGSVLGYVLFNLYVNDLSEH 131 >SB_31876| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 630 Score = 41.9 bits (94), Expect = 5e-04 Identities = 22/46 (47%), Positives = 26/46 (56%) Frame = -1 Query: 265 RHILGNSSFRYRVEGTRSRPRHVTAGVPQGSALSPLLFSLYINDIP 128 R L N + R + S VT GVPQGS L PLLF +YIN +P Sbjct: 382 RSYLANRTQRTCCGNSLSEELPVTHGVPQGSILGPLLFVIYINSLP 427 >SB_54068| Best HMM Match : RVT_1 (HMM E-Value=0.92) Length = 208 Score = 41.9 bits (94), Expect = 5e-04 Identities = 22/46 (47%), Positives = 26/46 (56%) Frame = -1 Query: 265 RHILGNSSFRYRVEGTRSRPRHVTAGVPQGSALSPLLFSLYINDIP 128 R L N + R + S VT GVPQGS L PLLF +YIN +P Sbjct: 44 RSYLANRTQRTCCGNSLSEELPVTHGVPQGSILGPLLFVIYINSLP 89 >SB_51232| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1676 Score = 41.9 bits (94), Expect = 5e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -1 Query: 259 ILGNSSFRYRVEGTRSRPRHVTAGVPQGSALSPLLFSLYINDI 131 +L N S V+G +S VT+GVP G+ L P LF L+INDI Sbjct: 814 LLTNRSQFVAVDGAKSNAVPVTSGVPHGTFLGPTLFLLFINDI 856 >SB_47851| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 893 Score = 41.9 bits (94), Expect = 5e-04 Identities = 17/34 (50%), Positives = 24/34 (70%) Frame = -1 Query: 229 VEGTRSRPRHVTAGVPQGSALSPLLFSLYINDIP 128 + G S + +T GVP+GS L PL+F L+IND+P Sbjct: 672 ISGQLSDSQPITVGVPRGSILGPLMFILFINDLP 705 >SB_19795| Best HMM Match : RVT_1 (HMM E-Value=1.3) Length = 171 Score = 41.9 bits (94), Expect = 5e-04 Identities = 22/46 (47%), Positives = 26/46 (56%) Frame = -1 Query: 265 RHILGNSSFRYRVEGTRSRPRHVTAGVPQGSALSPLLFSLYINDIP 128 R L N + R + S VT GVPQGS L PLLF +YIN +P Sbjct: 44 RSYLANRTQRTCCGNSLSEELPVTHGVPQGSILGPLLFVIYINSLP 89 >SB_6463| Best HMM Match : RVT_1 (HMM E-Value=2.2e-13) Length = 675 Score = 41.9 bits (94), Expect = 5e-04 Identities = 17/34 (50%), Positives = 24/34 (70%) Frame = -1 Query: 229 VEGTRSRPRHVTAGVPQGSALSPLLFSLYINDIP 128 + G S + +T GVP+GS L PL+F L+IND+P Sbjct: 454 ISGQLSDSQPITVGVPRGSILGPLMFILFINDLP 487 >SB_25119| Best HMM Match : Ribosomal_S27 (HMM E-Value=9.4) Length = 443 Score = 41.5 bits (93), Expect = 6e-04 Identities = 20/31 (64%), Positives = 21/31 (67%) Frame = -1 Query: 223 GTRSRPRHVTAGVPQGSALSPLLFSLYINDI 131 GT S VT+GVPQG L P LF LYINDI Sbjct: 9 GTHSDKVQVTSGVPQGFELGPTLFLLYINDI 39 >SB_20001| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 722 Score = 41.5 bits (93), Expect = 6e-04 Identities = 20/43 (46%), Positives = 26/43 (60%) Frame = -1 Query: 256 LGNSSFRYRVEGTRSRPRHVTAGVPQGSALSPLLFSLYINDIP 128 LGN + V+G S +VT GVPQ S L L+F +Y+ND P Sbjct: 103 LGNIRQQCYVKGVLSDEEYVTCGVPQRSILGRLVFLIYVNDFP 145 >SB_17732| Best HMM Match : RVT_1 (HMM E-Value=1.5e-27) Length = 399 Score = 41.5 bits (93), Expect = 6e-04 Identities = 18/31 (58%), Positives = 22/31 (70%) Frame = -1 Query: 223 GTRSRPRHVTAGVPQGSALSPLLFSLYINDI 131 G S ++V GVPQGS L PLLF +YIND+ Sbjct: 173 GHLSSCKYVNCGVPQGSVLGPLLFHIYINDL 203 >SB_12291| Best HMM Match : Exo_endo_phos (HMM E-Value=1.8e-09) Length = 843 Score = 41.1 bits (92), Expect = 8e-04 Identities = 19/37 (51%), Positives = 24/37 (64%) Frame = -1 Query: 238 RYRVEGTRSRPRHVTAGVPQGSALSPLLFSLYINDIP 128 R V G S V +GVPQG+ L P+LF L+IND+P Sbjct: 511 RVVVNGASSTWSPVLSGVPQGTVLGPILFLLFINDLP 547 >SB_10379| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 265 Score = 41.1 bits (92), Expect = 8e-04 Identities = 19/37 (51%), Positives = 24/37 (64%) Frame = -1 Query: 238 RYRVEGTRSRPRHVTAGVPQGSALSPLLFSLYINDIP 128 R V G S V +GVPQG+ L P+LF L+IND+P Sbjct: 4 RVVVNGASSTWSPVLSGVPQGTVLGPILFLLFINDLP 40 >SB_5816| Best HMM Match : RVT_1 (HMM E-Value=3e-16) Length = 904 Score = 41.1 bits (92), Expect = 8e-04 Identities = 18/35 (51%), Positives = 23/35 (65%) Frame = -1 Query: 232 RVEGTRSRPRHVTAGVPQGSALSPLLFSLYINDIP 128 +V+G S + GVPQGS L PL F L+IND+P Sbjct: 467 QVDGEVSSEMKINHGVPQGSILGPLFFLLFINDLP 501 >SB_58989| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 885 Score = 41.1 bits (92), Expect = 8e-04 Identities = 18/34 (52%), Positives = 24/34 (70%) Frame = -1 Query: 229 VEGTRSRPRHVTAGVPQGSALSPLLFSLYINDIP 128 V+G +S V +GVPQGS + P+LF YIND+P Sbjct: 45 VDGEQSDFTPVLSGVPQGSVIGPVLFLAYINDLP 78 Score = 41.1 bits (92), Expect = 8e-04 Identities = 18/34 (52%), Positives = 24/34 (70%) Frame = -1 Query: 229 VEGTRSRPRHVTAGVPQGSALSPLLFSLYINDIP 128 V+G +S V +GVPQGS + P+LF YIND+P Sbjct: 568 VDGEQSDFTPVLSGVPQGSVIGPVLFLAYINDLP 601 >SB_38372| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 402 Score = 41.1 bits (92), Expect = 8e-04 Identities = 20/33 (60%), Positives = 22/33 (66%) Frame = -1 Query: 229 VEGTRSRPRHVTAGVPQGSALSPLLFSLYINDI 131 V GT S VT+GVPQGS L P F L+INDI Sbjct: 200 VNGTHSSCTPVTSGVPQGSVLGPGFFLLFINDI 232 Score = 29.9 bits (64), Expect = 2.1 Identities = 15/36 (41%), Positives = 21/36 (58%) Frame = -2 Query: 114 THLALFADDTAIYYSCRKKALLHRRLQTAATTMGQW 7 +HL LFADDT +Y + R A H+ LQ + +W Sbjct: 238 SHLRLFADDTVVYRNIR-SADNHQVLQQDLDNLTKW 272 >SB_30161| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 265 Score = 41.1 bits (92), Expect = 8e-04 Identities = 19/37 (51%), Positives = 24/37 (64%) Frame = -1 Query: 238 RYRVEGTRSRPRHVTAGVPQGSALSPLLFSLYINDIP 128 R V G S V +GVPQG+ L P+LF L+IND+P Sbjct: 4 RVVVNGASSTWSPVLSGVPQGTVLGPILFLLFINDLP 40 >SB_43617| Best HMM Match : RVT_1 (HMM E-Value=3e-21) Length = 314 Score = 40.7 bits (91), Expect = 0.001 Identities = 18/33 (54%), Positives = 24/33 (72%) Frame = -1 Query: 229 VEGTRSRPRHVTAGVPQGSALSPLLFSLYINDI 131 V+G+ S VT+GVPQG+ L P LF ++INDI Sbjct: 102 VDGSHSSQVPVTSGVPQGTVLGPTLFLVFINDI 134 >SB_35376| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 931 Score = 40.7 bits (91), Expect = 0.001 Identities = 18/33 (54%), Positives = 24/33 (72%) Frame = -1 Query: 229 VEGTRSRPRHVTAGVPQGSALSPLLFSLYINDI 131 V+G+ S VT+GVPQG+ L P LF ++INDI Sbjct: 579 VDGSHSSQVPVTSGVPQGTVLGPTLFLVFINDI 611 >SB_21844| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 411 Score = 40.7 bits (91), Expect = 0.001 Identities = 18/33 (54%), Positives = 24/33 (72%) Frame = -1 Query: 229 VEGTRSRPRHVTAGVPQGSALSPLLFSLYINDI 131 V+G+ S VT+GVPQG+ L P LF ++INDI Sbjct: 187 VDGSHSSQVPVTSGVPQGTVLGPTLFLVFINDI 219 >SB_56177| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 294 Score = 40.7 bits (91), Expect = 0.001 Identities = 16/32 (50%), Positives = 22/32 (68%) Frame = -1 Query: 223 GTRSRPRHVTAGVPQGSALSPLLFSLYINDIP 128 G S+P + +GVPQ S L P LF +Y+ND+P Sbjct: 50 GALSKPLPIFSGVPQSSILGPALFLIYVNDLP 81 >SB_52464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2529 Score = 40.7 bits (91), Expect = 0.001 Identities = 18/33 (54%), Positives = 24/33 (72%) Frame = -1 Query: 229 VEGTRSRPRHVTAGVPQGSALSPLLFSLYINDI 131 V+G+ S VT+GVPQG+ L P LF ++INDI Sbjct: 1305 VDGSHSSQVPVTSGVPQGTVLGPTLFLVFINDI 1337 >SB_42891| Best HMM Match : DUF537 (HMM E-Value=1.2e-23) Length = 2386 Score = 40.7 bits (91), Expect = 0.001 Identities = 18/33 (54%), Positives = 24/33 (72%) Frame = -1 Query: 229 VEGTRSRPRHVTAGVPQGSALSPLLFSLYINDI 131 V+G+ S VT+GVPQG+ L P LF ++INDI Sbjct: 185 VDGSHSSQVPVTSGVPQGTVLGPTLFLVFINDI 217 >SB_38806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 430 Score = 40.7 bits (91), Expect = 0.001 Identities = 21/46 (45%), Positives = 27/46 (58%) Frame = -1 Query: 265 RHILGNSSFRYRVEGTRSRPRHVTAGVPQGSALSPLLFSLYINDIP 128 R L + + R + S+ VT GVPQGS L PLLF +YIN +P Sbjct: 216 RSYLASRTQRTCCGNSLSKELPVTHGVPQGSILGPLLFVIYINSLP 261 >SB_36891| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2124 Score = 40.7 bits (91), Expect = 0.001 Identities = 18/33 (54%), Positives = 24/33 (72%) Frame = -1 Query: 229 VEGTRSRPRHVTAGVPQGSALSPLLFSLYINDI 131 V+G+ S VT+GVPQG+ L P LF ++INDI Sbjct: 1969 VDGSHSSQVPVTSGVPQGTVLGPTLFLVFINDI 2001 >SB_30407| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 788 Score = 40.7 bits (91), Expect = 0.001 Identities = 18/33 (54%), Positives = 24/33 (72%) Frame = -1 Query: 229 VEGTRSRPRHVTAGVPQGSALSPLLFSLYINDI 131 V+G+ S VT+GVPQG+ L P LF ++INDI Sbjct: 289 VDGSHSSQVPVTSGVPQGTVLGPTLFLVFINDI 321 >SB_28762| Best HMM Match : RVT_1 (HMM E-Value=3.9e-23) Length = 409 Score = 40.7 bits (91), Expect = 0.001 Identities = 18/33 (54%), Positives = 24/33 (72%) Frame = -1 Query: 229 VEGTRSRPRHVTAGVPQGSALSPLLFSLYINDI 131 V+G+ S VT+GVPQG+ L P LF ++INDI Sbjct: 102 VDGSHSSQVPVTSGVPQGTVLGPTLFLVFINDI 134 >SB_19106| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 217 Score = 40.7 bits (91), Expect = 0.001 Identities = 18/33 (54%), Positives = 24/33 (72%) Frame = -1 Query: 229 VEGTRSRPRHVTAGVPQGSALSPLLFSLYINDI 131 V+G+ S VT+GVPQG+ L P LF ++INDI Sbjct: 179 VDGSHSSQVPVTSGVPQGTVLGPTLFLVFINDI 211 >SB_12274| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 295 Score = 40.7 bits (91), Expect = 0.001 Identities = 18/33 (54%), Positives = 24/33 (72%) Frame = -1 Query: 229 VEGTRSRPRHVTAGVPQGSALSPLLFSLYINDI 131 V+G+ S VT+GVPQG+ L P LF ++INDI Sbjct: 257 VDGSHSSQVPVTSGVPQGTVLGPTLFLVFINDI 289 >SB_11572| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 888 Score = 40.7 bits (91), Expect = 0.001 Identities = 18/33 (54%), Positives = 24/33 (72%) Frame = -1 Query: 229 VEGTRSRPRHVTAGVPQGSALSPLLFSLYINDI 131 V+G+ S VT+GVPQG+ L P LF ++INDI Sbjct: 318 VDGSHSSQVPVTSGVPQGTVLGPTLFLVFINDI 350 >SB_7145| Best HMM Match : RVT_1 (HMM E-Value=3.8e-25) Length = 455 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/34 (55%), Positives = 22/34 (64%) Frame = -1 Query: 223 GTRSRPRHVTAGVPQGSALSPLLFSLYINDIPRY 122 G S VT+GV QGS L PLLF +Y ND+P Y Sbjct: 267 GVSSSWLSVTSGVAQGSILGPLLFLVYANDMPNY 300 >SB_59383| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 709 Score = 40.3 bits (90), Expect = 0.001 Identities = 17/35 (48%), Positives = 22/35 (62%) Frame = -1 Query: 226 EGTRSRPRHVTAGVPQGSALSPLLFSLYINDIPRY 122 +G S + GVPQGS L PL F L+IND+P + Sbjct: 515 KGVLSNALPINVGVPQGSILGPLFFLLFINDLPLF 549 >SB_35480| Best HMM Match : RVT_1 (HMM E-Value=0.0085) Length = 243 Score = 40.3 bits (90), Expect = 0.001 Identities = 20/48 (41%), Positives = 29/48 (60%) Frame = -1 Query: 271 YTRHILGNSSFRYRVEGTRSRPRHVTAGVPQGSALSPLLFSLYINDIP 128 + R+ L + R V G S V +GVPQG+ L P+LF ++IND+P Sbjct: 65 WLRNFLIDRRQRVVVNGACSSWSTVLSGVPQGTVLGPILFLMFINDMP 112 >SB_32837| Best HMM Match : RVT_1 (HMM E-Value=8.3e-17) Length = 327 Score = 40.3 bits (90), Expect = 0.001 Identities = 20/48 (41%), Positives = 29/48 (60%) Frame = -1 Query: 271 YTRHILGNSSFRYRVEGTRSRPRHVTAGVPQGSALSPLLFSLYINDIP 128 + R+ L + R V G S V +GVPQG+ L P+LF ++IND+P Sbjct: 88 WLRNFLIDRRQRVVVNGACSSWSTVLSGVPQGTVLGPILFLMFINDMP 135 >SB_27763| Best HMM Match : VapD_N (HMM E-Value=10) Length = 243 Score = 40.3 bits (90), Expect = 0.001 Identities = 20/48 (41%), Positives = 29/48 (60%) Frame = -1 Query: 271 YTRHILGNSSFRYRVEGTRSRPRHVTAGVPQGSALSPLLFSLYINDIP 128 + R+ L + R V G S V +GVPQG+ L P+LF ++IND+P Sbjct: 4 WLRNFLIDRRQRVVVNGACSSWSTVLSGVPQGTVLGPILFLMFINDMP 51 >SB_24816| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 662 Score = 40.3 bits (90), Expect = 0.001 Identities = 16/33 (48%), Positives = 23/33 (69%) Frame = -1 Query: 229 VEGTRSRPRHVTAGVPQGSALSPLLFSLYINDI 131 ++G S P +GVPQG+ L PL+F +YIND+ Sbjct: 355 LDGASSAPVKTRSGVPQGTVLGPLMFLIYINDM 387 >SB_52616| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1855 Score = 40.3 bits (90), Expect = 0.001 Identities = 20/48 (41%), Positives = 29/48 (60%) Frame = -1 Query: 271 YTRHILGNSSFRYRVEGTRSRPRHVTAGVPQGSALSPLLFSLYINDIP 128 + R+ L + R V G S V +GVPQG+ L P+LF ++IND+P Sbjct: 1659 WLRNFLIDRRQRVVVNGACSSWSTVLSGVPQGTVLGPILFLMFINDMP 1706 Score = 29.5 bits (63), Expect = 2.7 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = -1 Query: 178 GSALSPLLFSLYINDIPR 125 GS L PL F +YIND+P+ Sbjct: 664 GSILGPLFFLIYINDLPQ 681 >SB_34368| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 542 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/31 (61%), Positives = 21/31 (67%) Frame = -1 Query: 223 GTRSRPRHVTAGVPQGSALSPLLFSLYINDI 131 G S + V GVPQGS L PLLF +YINDI Sbjct: 399 GVSSCRKLVKCGVPQGSVLGPLLFLIYINDI 429 >SB_26483| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1702 Score = 40.3 bits (90), Expect = 0.001 Identities = 20/48 (41%), Positives = 29/48 (60%) Frame = -1 Query: 271 YTRHILGNSSFRYRVEGTRSRPRHVTAGVPQGSALSPLLFSLYINDIP 128 + R+ L + R V G S V +GVPQG+ L P+LF ++IND+P Sbjct: 497 WLRNFLIDRRQRVVVNGACSSWSTVLSGVPQGTVLGPILFLMFINDMP 544 >SB_22732| Best HMM Match : RVT_1 (HMM E-Value=2.2e-23) Length = 457 Score = 40.3 bits (90), Expect = 0.001 Identities = 17/35 (48%), Positives = 22/35 (62%) Frame = -1 Query: 226 EGTRSRPRHVTAGVPQGSALSPLLFSLYINDIPRY 122 +G S + GVPQGS L PL F L+IND+P + Sbjct: 297 KGVLSNALPINVGVPQGSILGPLFFLLFINDLPLF 331 >SB_11382| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 40.3 bits (90), Expect = 0.001 Identities = 17/33 (51%), Positives = 24/33 (72%) Frame = -1 Query: 229 VEGTRSRPRHVTAGVPQGSALSPLLFSLYINDI 131 + + S P VT+GVPQG+ L PL+F L+IND+ Sbjct: 4 ITNSSSVPVDVTSGVPQGTVLGPLMFLLFINDM 36 >SB_10718| Best HMM Match : RVT_1 (HMM E-Value=2.3e-33) Length = 365 Score = 40.3 bits (90), Expect = 0.001 Identities = 21/46 (45%), Positives = 26/46 (56%) Frame = -1 Query: 265 RHILGNSSFRYRVEGTRSRPRHVTAGVPQGSALSPLLFSLYINDIP 128 R L + + R + S VT GVPQGS L PLLF +YIN +P Sbjct: 264 RSYLASRTQRICCGNSLSEELPVTHGVPQGSILGPLLFVIYINSLP 309 >SB_10516| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 381 Score = 40.3 bits (90), Expect = 0.001 Identities = 17/35 (48%), Positives = 22/35 (62%) Frame = -1 Query: 226 EGTRSRPRHVTAGVPQGSALSPLLFSLYINDIPRY 122 +G S + GVPQGS L PL F L+IND+P + Sbjct: 57 KGVLSNALPINVGVPQGSILGPLFFLLFINDLPLF 91 >SB_10251| Best HMM Match : RVT_1 (HMM E-Value=0.0022) Length = 717 Score = 40.3 bits (90), Expect = 0.001 Identities = 17/39 (43%), Positives = 24/39 (61%) Frame = -1 Query: 244 SFRYRVEGTRSRPRHVTAGVPQGSALSPLLFSLYINDIP 128 + + ++ T S +T G+PQ S L PL F LYIND+P Sbjct: 496 TLKCQLNSTVSSESKITCGIPQRSILGPLFFLLYINDLP 534 >SB_18451| Best HMM Match : Sorb (HMM E-Value=9.2) Length = 323 Score = 39.9 bits (89), Expect = 0.002 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = -1 Query: 220 TRSRPRHVTAGVPQGSALSPLLFSLYINDIP 128 T S +T G+PQG L PL F LYIND+P Sbjct: 7 TVSSESKITCGIPQGLILGPLFFLLYINDLP 37 >SB_26407| Best HMM Match : UQ_con (HMM E-Value=0) Length = 1282 Score = 39.9 bits (89), Expect = 0.002 Identities = 18/43 (41%), Positives = 26/43 (60%) Frame = -1 Query: 256 LGNSSFRYRVEGTRSRPRHVTAGVPQGSALSPLLFSLYINDIP 128 L S + V G S + ++ G+PQ S + PLLF +YIND+P Sbjct: 904 LEERSQKCSVNGHLSNAQAISLGIPQRSIIGPLLFLIYINDLP 946 >SB_14872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1182 Score = 39.9 bits (89), Expect = 0.002 Identities = 17/24 (70%), Positives = 19/24 (79%) Frame = -1 Query: 199 VTAGVPQGSALSPLLFSLYINDIP 128 VT GVPQGS L PLLF +YIN +P Sbjct: 536 VTHGVPQGSILGPLLFVIYINSLP 559 >SB_11746| Best HMM Match : RVT_1 (HMM E-Value=5e-31) Length = 323 Score = 39.9 bits (89), Expect = 0.002 Identities = 20/48 (41%), Positives = 27/48 (56%) Frame = -1 Query: 256 LGNSSFRYRVEGTRSRPRHVTAGVPQGSALSPLLFSLYINDIPRYXGD 113 L N ++ S +T GVPQGS L PLLF +Y+ND+ +Y D Sbjct: 124 LTNRKQTTEIKNCISEKSSITCGVPQGSILGPLLFLIYMNDM-QYSSD 170 >SB_9873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 39.9 bits (89), Expect = 0.002 Identities = 17/24 (70%), Positives = 19/24 (79%) Frame = -1 Query: 199 VTAGVPQGSALSPLLFSLYINDIP 128 VT GVPQGS L PLLF +YIN +P Sbjct: 15 VTHGVPQGSILGPLLFVIYINSLP 38 >SB_9841| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 39.9 bits (89), Expect = 0.002 Identities = 17/32 (53%), Positives = 22/32 (68%) Frame = -1 Query: 223 GTRSRPRHVTAGVPQGSALSPLLFSLYINDIP 128 G S + +TAGVPQ S L P +F L+IND+P Sbjct: 105 GQLSDSQPITAGVPQSSILGPFMFILFINDLP 136 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,602,331 Number of Sequences: 59808 Number of extensions: 499060 Number of successful extensions: 2112 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 1824 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2110 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1829596184 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -