BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0456 (750 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g77310.1 68414.m09004 wound-responsive protein, putative simi... 29 4.4 At3g17890.1 68416.m02279 expressed protein 28 7.6 >At1g77310.1 68414.m09004 wound-responsive protein, putative similar to wound-responsive protein 14.05 (GI:16506638) [Castanea sativa] Length = 699 Score = 28.7 bits (61), Expect = 4.4 Identities = 19/53 (35%), Positives = 27/53 (50%), Gaps = 4/53 (7%) Frame = +3 Query: 54 TMSDDGSTVVEKKG-RGRPKANGTQPESKELKK---RGRPPAATRTKDSAKSS 200 T S + +K G GRPK + + + L+K RPPAAT +D+ SS Sbjct: 326 TESKTSIQISKKSGSNGRPKYSTLEKAIRNLEKLVAESRPPAATENQDADISS 378 >At3g17890.1 68416.m02279 expressed protein Length = 153 Score = 27.9 bits (59), Expect = 7.6 Identities = 13/38 (34%), Positives = 22/38 (57%), Gaps = 3/38 (7%) Frame = +3 Query: 114 NGTQPESKELKKRGRPPAATRTKD---SAKSSDDEQAP 218 NG+QPE+ + K RP +TK+ + KS + ++ P Sbjct: 21 NGSQPEAPKTKAEKRPKRVQKTKEKDLNLKSDEPKRVP 58 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,914,930 Number of Sequences: 28952 Number of extensions: 198455 Number of successful extensions: 640 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 614 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 640 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1663169840 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -