BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0453 (800 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY490815-1|AAR82970.1| 136|Tribolium castaneum glass protein pr... 24 1.6 AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein pr... 24 1.6 AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 22 5.0 AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. 22 5.0 >AY490815-1|AAR82970.1| 136|Tribolium castaneum glass protein protein. Length = 136 Score = 23.8 bits (49), Expect = 1.6 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = +1 Query: 478 HSTFKPFRYCGCDSMINVDFDXATHSITRS 567 HS KPFR CD + TH T S Sbjct: 44 HSGEKPFRCPVCDRRFSQSSSVTTHMRTHS 73 >AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein protein. Length = 392 Score = 23.8 bits (49), Expect = 1.6 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = +1 Query: 478 HSTFKPFRYCGCDSMINVDFDXATHSITRS 567 HS KPFR CD + TH T S Sbjct: 300 HSGEKPFRCPVCDRRFSQSSSVTTHMRTHS 329 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 22.2 bits (45), Expect = 5.0 Identities = 8/16 (50%), Positives = 9/16 (56%) Frame = +1 Query: 58 PCRPTNEALARRGRHG 105 PCRP + RR HG Sbjct: 589 PCRPREQLTWRRNFHG 604 >AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. Length = 682 Score = 22.2 bits (45), Expect = 5.0 Identities = 8/16 (50%), Positives = 9/16 (56%) Frame = +1 Query: 58 PCRPTNEALARRGRHG 105 PCRP + RR HG Sbjct: 481 PCRPREQLTWRRNFHG 496 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 160,745 Number of Sequences: 336 Number of extensions: 3014 Number of successful extensions: 8 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 21791490 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -