BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0453 (800 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ441131-1|CAD29630.1| 567|Anopheles gambiae putative chitin bi... 25 2.1 AJ439060-17|CAD27768.1| 568|Anopheles gambiae putative chitin b... 25 2.1 AJ010903-1|CAA09389.1| 373|Anopheles gambiae ICHIT protein prot... 25 3.6 >AJ441131-1|CAD29630.1| 567|Anopheles gambiae putative chitin binding protein protein. Length = 567 Score = 25.4 bits (53), Expect = 2.1 Identities = 19/55 (34%), Positives = 27/55 (49%), Gaps = 1/55 (1%) Frame = -2 Query: 718 MTESHLNANAELCAN*KCFTTEVFLKYCEWYRVFDVSSIKS-YTFNLNLTYSYEL 557 +T+ L + LC F V LK C W+ D S K+ Y NL ++ SY+L Sbjct: 407 LTDDGLIMKSFLCPESTLFDQTV-LK-CNWWFYVDCKSSKNLYDSNLPVSKSYQL 459 >AJ439060-17|CAD27768.1| 568|Anopheles gambiae putative chitin binding protein protein. Length = 568 Score = 25.4 bits (53), Expect = 2.1 Identities = 19/55 (34%), Positives = 27/55 (49%), Gaps = 1/55 (1%) Frame = -2 Query: 718 MTESHLNANAELCAN*KCFTTEVFLKYCEWYRVFDVSSIKS-YTFNLNLTYSYEL 557 +T+ L + LC F V LK C W+ D S K+ Y NL ++ SY+L Sbjct: 415 LTDDGLIMKSFLCPESTLFDQTV-LK-CNWWFYVDCKSSKNLYDSNLPVSKSYQL 467 >AJ010903-1|CAA09389.1| 373|Anopheles gambiae ICHIT protein protein. Length = 373 Score = 24.6 bits (51), Expect = 3.6 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +1 Query: 19 PSDPKPTSPARGAPCRPTNEALARRGRHGT 108 PS P PT P C PT L HGT Sbjct: 279 PSTPHPTDPH----CPPTGATLPNYWAHGT 304 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 717,740 Number of Sequences: 2352 Number of extensions: 13661 Number of successful extensions: 15 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 84408009 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -