BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0451 (750 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_01_0723 - 5287864-5287885,5287971-5288043,5288521-5288626,528... 30 2.3 >06_01_0723 - 5287864-5287885,5287971-5288043,5288521-5288626, 5288829-5288891,5290165-5290249,5290337-5290377, 5291260-5291323,5291647-5291716,5291886-5291960, 5292070-5292164,5293671-5293771,5293852-5293874, 5293956-5294031,5294229-5294322,5294493-5294548, 5296204-5296327,5296607-5296743 Length = 434 Score = 29.9 bits (64), Expect = 2.3 Identities = 14/41 (34%), Positives = 24/41 (58%) Frame = -1 Query: 615 SVDYYCHIWPAXICIMXKYLCLFIYCFFRVSVFIYFAVIFV 493 S+ Y I A I ++ + L LF+YC + V ++++ AV V Sbjct: 375 SIKRYIIITIARIPLVDELLVLFLYCAYTVGLYLHLAVSVV 415 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,150,931 Number of Sequences: 37544 Number of extensions: 213273 Number of successful extensions: 284 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 284 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 284 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1992480932 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -