BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0446 (700 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. 23 1.8 AY490815-1|AAR82970.1| 136|Tribolium castaneum glass protein pr... 23 1.8 AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein pr... 23 1.8 AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 22 4.2 AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. 22 4.2 AY675073-1|AAV74190.1| 533|Tribolium castaneum chitinase 5 prot... 22 4.2 >X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. Length = 524 Score = 23.4 bits (48), Expect = 1.8 Identities = 10/24 (41%), Positives = 12/24 (50%) Frame = +2 Query: 596 QKPYTISQYFKNTSVVKHFQLAHN 667 Q P T F +T +V HF HN Sbjct: 81 QSPQTQPARFYSTPIVPHFAYNHN 104 >AY490815-1|AAR82970.1| 136|Tribolium castaneum glass protein protein. Length = 136 Score = 23.4 bits (48), Expect = 1.8 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = +2 Query: 458 HSTFKPFRYCGCDSMINVDFDEATHSITRS 547 HS KPFR CD + TH T S Sbjct: 44 HSGEKPFRCPVCDRRFSQSSSVTTHMRTHS 73 >AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein protein. Length = 392 Score = 23.4 bits (48), Expect = 1.8 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = +2 Query: 458 HSTFKPFRYCGCDSMINVDFDEATHSITRS 547 HS KPFR CD + TH T S Sbjct: 300 HSGEKPFRCPVCDRRFSQSSSVTTHMRTHS 329 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 22.2 bits (45), Expect = 4.2 Identities = 8/16 (50%), Positives = 9/16 (56%) Frame = +2 Query: 38 PCRPTNEALARRGRHG 85 PCRP + RR HG Sbjct: 589 PCRPREQLTWRRNFHG 604 >AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. Length = 682 Score = 22.2 bits (45), Expect = 4.2 Identities = 8/16 (50%), Positives = 9/16 (56%) Frame = +2 Query: 38 PCRPTNEALARRGRHG 85 PCRP + RR HG Sbjct: 481 PCRPREQLTWRRNFHG 496 >AY675073-1|AAV74190.1| 533|Tribolium castaneum chitinase 5 protein. Length = 533 Score = 22.2 bits (45), Expect = 4.2 Identities = 7/16 (43%), Positives = 12/16 (75%) Frame = -1 Query: 364 PRLINVSLPYFGDTFT 317 P+ + V +P++G TFT Sbjct: 259 PKKLIVGIPFYGRTFT 274 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 147,096 Number of Sequences: 336 Number of extensions: 2966 Number of successful extensions: 7 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18426585 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -